KEGG   Legionella longbeachae: LLO_3057Help
Entry
LLO_3057          CDS       T01183                                 

Definition
(GenBank) putative Protein with TPR motifs (protein-protein interaction motif)
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_8 TPR_17 TPR_11 TPR_16 TPR_19 TPR_12 TPR_7 TPR_14 TPR_9 TPR_6 TPR_10 ANAPC3 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_25 EST1_DNA_bind Methyltransf_31 NodS Coatomer_E MTS PCMT TehB HrpB1_HrpK Methyltransf_16 NARP1 DUF2989 PrmA N6_N4_Mtase DUF4919 Uds1
Motif
Other DBs
NCBI-ProteinID: CBJ13507
Pasteur: llo3057
UniProt: D3HM21
Position
3553210..3554910
Genome map
AA seq 566 aa AA seqDB search
MNIEALFAQAYKFQYEGQLPQAISIYEQILTKEPGHLNSLHFLGLIYAQLGDMDNAILYL
LQALSISPNDVSLLNNLANAYKKTHLLDKAIEYYQRAIQLDPEYAQAQNNLATVYAMQNN
YSKALFHYTKAVHAEPDFSAAHFNLGLLLLQNNQLEAAKTQFNNVISLNPLHTESLFYLG
VLHLEKNDLFEAENAFQNVLKQDDKQIEALSNLGVIALKRHQNQLAVDFFTRALALDNDN
TEARNNLAATFMHHDRFENALMHYDVLLQKDPDNLEYLYNSGVAQMALGHLNEAILHFEH
ITRLESKHTSTLNNLAAIYIKMDQKEKAQEYLERALEINPKDTISAHMLHAIKGDRHAQT
TPEYAHNLFNNYALYYDQHMKGALHYSVPQHIARTIHQLELPINIHTLDLGCGTGLTGIV
LREVSKYLVGVDIAAKMLAQAKEKEIYDNLFESEINQFLLQNKNFYDLIVAADVLPYFGE
LEALFHSIHLHLKRQGYFIFTAEISTSTHWHLETSARFSHHPDYIAQLAKQNNFHLLKQE
KIPARKQNNQPLEVMLYVLKNATWLN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaagcactttttgcgcaagcatacaaattccaatatgaaggccaactccca
caagccattagcatttatgagcaaatattgaccaaagaacccggacatttgaatagcttg
cattttttagggcttatttacgctcaattaggggatatggataatgcgattctatactta
ttacaagccctttcaatcagtcccaatgatgtcagtttgcttaacaatttagctaatgcc
tataaaaaaacacatctactggataaggctattgaatattatcagcgtgcaatacaactt
gatccagagtatgcacaagcacagaacaatcttgcaacggtttatgctatgcaaaataat
tattcaaaagcattattccattataccaaagcagttcatgctgaacccgattttagtgct
gcacactttaatttaggtttattattactccaaaacaatcaattagaagcagcaaaaact
caattcaataatgtgatctctttaaatccgttacacacagaatctcttttctatttaggt
gtcttgcatttagaaaaaaatgatctttttgaagctgaaaatgcttttcaaaatgttttg
aaacaggatgataaacaaatagaagccctttcgaatttaggcgtaattgcattaaaaagg
catcaaaatcaattagcagttgattttttcacgagagcattggctctagacaacgacaat
accgaagcgcgtaataatctggctgcaacattcatgcatcacgaccgttttgaaaatgct
ctcatgcattatgatgttttactacaaaaagatcctgataaccttgaatatttatacaat
tcaggtgtggctcaaatggcattaggacatttgaatgaagcaattcttcattttgagcat
attacgcggttagaaagcaagcatacttccacattaaataatttggccgcaatttatatt
aaaatggaccagaaagaaaaggcacaagaatatttggaacgcgctttagagattaatcct
aaagatacaatcagcgctcatatgctccatgccataaaaggggatagacatgcacaaact
acccctgaatatgctcataacttatttaataattacgcactgtattacgatcaacatatg
aaaggcgcccttcattactcggtgcctcaacatattgcacgtacaatccaccagctggaa
ttaccaatcaatattcataccctggacctcggatgcggaacggggttaactggcattgtg
ctccgcgaagtgagcaaatatttagtaggggtcgatattgcagcaaaaatgttggctcag
gctaaggaaaaagaaatttatgataatttattcgagtcagaaataaatcaatttcttttg
caaaacaaaaatttttatgatttgattgtggctgctgacgtccttccctatttcggagaa
cttgaggccttatttcattccattcatttacacctaaaacgccaaggttattttattttt
actgcagaaataagcacttctactcattggcacctcgaaacaagcgctcgttttagccat
catcctgattatatagctcagttagctaagcaaaataactttcatttactaaaacaggaa
aaaattccagcacgaaaacaaaataatcaacctcttgaagtcatgctgtacgtattaaaa
aatgctacttggctcaattga

DBGET integrated database retrieval system