KEGG   Legionella longbeachae: LLO_3064Help
Entry
LLO_3064          CDS       T01183                                 

Gene name
radC
Definition
(GenBank) DNA repair protein RadC (start is missing)
  KO
K03630  DNA repair protein RadC
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    LLO_3064 (radC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RadC Prok-JAB ELYS
Motif
Other DBs
NCBI-ProteinID: CBJ13514
Pasteur: llo3064
UniProt: D3HM28
Position
3561610..3562185
Genome map
AA seq 191 aa AA seqDB search
MQLACDLLAHLGDLRAILNADTQSFKQVKGLGEAQYVQLQAVKEICRRSDFIQIQKENQI
TNSKQTYVYLKKRLRDYKNETFVALFLDNQHRIIAYDELFSGTINTATIHPRPIIERVLR
LNAAALILAHNHPSGVSDPSPQDIAVTERMREALELVDVRLLDHIIIGDNEVYSIIAEAK
WICHEQLALYN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagttagcatgcgaccttctcgctcatttaggtgatttacgtgccatccttaatgca
gacacacaaagtttcaaacaggtaaaaggattaggagaagctcagtatgtccagttacaa
gcggtaaaagaaatatgccgacgtagtgattttattcaaatccaaaaggaaaaccaaatt
actaatagcaaacaaacatatgtctatttaaaaaaacgtttacgtgattataaaaatgaa
acatttgttgcattgtttctagataatcaacaccgcattattgcttatgatgaacttttc
tccggaaccattaataccgcaacgattcacccaaggccaatcatagagcgagttcttaga
cttaatgctgcggcattaatacttgcgcacaatcacccatcaggtgtatctgatcccagc
ccccaagatatagcagtaacggagcgcatgcgtgaagcgttagagttagttgatgtgcga
ttgttggatcatatcattattggagataatgaagtttattccatcattgcggaagctaaa
tggatttgtcatgagcaattagctctttataactga

DBGET integrated database retrieval system