KEGG   Legionella longbeachae: LLO_3066Help
Entry
LLO_3066          CDS       T01183                                 

Gene name
poxA
Definition
(GenBank) lysyl-tRNA synthetase
  KO
K04568  elongation factor P--(R)-beta-lysine ligase [EC:6.3.1.-]
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:llo03012]
    LLO_3066 (poxA)
Enzymes [BR:llo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.-  
     LLO_3066 (poxA)
Translation factors [BR:llo03012]
 Prokaryotic Type
  Elongation factors
   LLO_3066 (poxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA-synt_2d DUF4498
Motif
Other DBs
NCBI-ProteinID: CBJ13516
Pasteur: llo3066
UniProt: D3HM30
Position
complement(3562767..3563708)
Genome map
AA seq 313 aa AA seqDB search
MWKPSASIELLRQRAELLKKIRYFFTERGYWEVETPIMARYGTTDVYLSNIEALFRGETY
YLQTSPEYHMKRLLAAGSGPIFQIARVFRDDELGRWHNPEFTLLEWYQLGIDHHTLIGEM
DLFLQMILESRPMLKKTYQHAFLEACHIDPFCATVDELRQVLVYFNLDKVLPANEEDKDQ
YLFLLMSHVVEPFLAKESVPVALYDFPSSQAALAKINNGVAERFEVYYQGVELANGFHEL
TDAAAQKKRFVLDQHLRNQKGLRAAEADQYLLNALEHGLPSCSGVALGVDRLLALALKKS
EIAQVISFDFLRA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccctctgcatccattgaattgttacgtcaacgtgctgaattattaaaaaaa
atacgttattttttcacggagcgtggttattgggaggtagagactcctataatggcgcgt
tacggtacaacagatgtttacttaagtaatatcgaagcgctatttcgaggtgaaacctat
tacttacaaacctctcctgaataccatatgaaacgtcttcttgcagcgggtagcggtccc
atttttcaaattgcacgcgtatttcgcgatgatgaattaggtcgttggcataatccagag
tttactttattagagtggtatcaattgggaattgatcaccatactttgattggagaaatg
gatttattcttacaaatgatcttggaatctaggcctatgcttaagaaaacctatcagcac
gcttttcttgaggcgtgtcatattgatcctttttgtgcaacagtggatgaacttcgccaa
gtattagtctattttaatttagacaaagtgctgcctgcgaatgaagaagataaagatcag
tatttatttttactgatgagccatgtagtcgagccttttttagctaaggagagtgttcct
gttgctttatatgattttccgagctcacaagctgctttagccaaaattaataatggcgtt
gctgaacgttttgaagtgtattatcaaggggtggaattagcgaatgggtttcatgagtta
accgatgctgctgctcagaaaaagcgttttgtcctggatcagcacctgcgcaatcaaaaa
gggcttcgcgccgctgaagcggatcaataccttttaaacgctttggagcatgggttacct
tcgtgcagtggtgtggctttaggagtcgataggctcttggctttggctctaaaaaaatct
gaaatagcacaagttatttcgtttgattttttaagagcatag

DBGET integrated database retrieval system