KEGG   Legionella longbeachae: LLO_3071Help
Entry
LLO_3071          CDS       T01183                                 

Gene name
sufC
Definition
(GenBank) component of SufBCD complex, ATP-binding component of ABC superfamily
  KO
K09013  Fe-S cluster assembly ATP-binding protein
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llo02000]
    LLO_3071 (sufC)
Transporters [BR:llo02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Orphan ABC ATPase
    LLO_3071 (sufC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_27 Cytidylate_kin AAA_13 AAA_18 AAA_23 AAA_28 AAA_33 AAA_22 AAA_25 AAA AAA_14
Motif
Other DBs
NCBI-ProteinID: CBJ13521
Pasteur: llo3071
UniProt: D3HM35
Position
complement(3567073..3567822)
Genome map
AA seq 249 aa AA seqDB search
MLKIKDLNVSVNGQAILKGIDLQVNAGEVHAIMGPNGSGKSTLSKVLAGHPSYQVTDGEI
SYLEQDLNPLSPEERARAGVFLSFQYPVEIPGVTNINFLKASVNAVRKGQGKNTLDAIEF
LTFIREKCQLLEMDESFLYRSINEGFSGGEKKRNEILQMAALEPKLAILDETDSGLDIDA
LRIISHGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLVNGRIILSGDKSLALELEKKG
YSWLEETVQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaattaaagacttaaatgtttcggtgaatggacaagccattttaaagggtatt
gatcttcaagtgaatgctggtgaagttcatgcaattatgggcccgaatggttctggtaaa
agtaccttatctaaagttttagctggtcatccttcttatcaagtcactgatggtgagatt
tcctatttggaacaagacctgaatcctttgtctccagaagaaagagcgcgtgccggagtt
tttctatcttttcaatatccggtagaaatacctggagtgaccaacattaattttcttaaa
gcttctgtgaatgcggtgcgtaaaggccaagggaaaaatacacttgatgctattgaattt
ttaacgttcattcgtgaaaaatgccagttgctcgaaatggatgagagttttttataccgt
agtatcaatgaaggattctcaggaggagaaaaaaagcgtaatgaaattttacagatggca
gccctagagcctaagcttgcaattctcgatgaaacagattcaggtttagatattgatgca
ttgcgtattatttctcatggtgttaatgcgatgcgatctcctgagcgctccattatttta
gtgacccattatcaacgcttacttgattacattgaaccggactttattcatgtgttggtt
aatgggcgtattattctttcaggcgataaatcccttgctcttgaattagagaaaaaaggg
tacagctggcttgaggaaacggtgcagtga

DBGET integrated database retrieval system