KEGG   Legionella longbeachae: LLO_3072Help
Entry
LLO_3072          CDS       T01183                                 

Gene name
sufB
Definition
(GenBank) component of SufBCD complex
  KO
K09014  Fe-S cluster assembly protein SufB
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    LLO_3072 (sufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0051
Motif
Other DBs
NCBI-ProteinID: CBJ13522
Pasteur: llo3072
UniProt: D3HM36
Position
complement(3567824..3569272)
Genome map
AA seq 482 aa AA seqDB search
MAKSSEQINSLLDREYQHGFTTDIEVDTFAPGLDEEVIRRLSAVKGEPEFLLEWRLKAYQ
HWLTMSPPQWSSVHYPPVDFQSISYYSAPKMKKDAPKSLDEVDPELLRTYEKLGIPLREQ
EMLAGVAVDAVFDSVSVATTFKAKLAEKGVIFCPISEAVHQYPELLMQYLGSVVSYRDNF
YAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAASTGQFERTLIVADVDSYVSYLEGC
TAPMRDENQLHAAVVELVALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACRGKRSK
ISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNYQQADTGTKMIHIGKNTRSTII
SKGISAGKAHNAYRGLVRIAPTAINARNYTQCDSMLMGSECSAHTFPYIEVKNPTAQVEH
EATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGLSLEGA
VG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaagcagtgagcaaattaattctctgctcgatagagaatatcaacatggtttt
acgaccgacattgaggtagatacttttgcaccaggactggacgaagaggttattcggcga
ttatcagcagttaaaggtgagccagaatttttactggagtggcgtttaaaagcctaccaa
cattggttaactatgtcccccccccaatggtctagtgtgcattatccaccagtggatttt
cagagtatttcttattattcagcgccaaaaatgaagaaagacgctcctaaaagtcttgat
gaggttgatcctgaattactaagaacttatgaaaaacttggtattcctttgagagaacaa
gaaatgcttgctggtgttgctgtagatgctgtttttgatagtgtttctgtagcgaccacc
tttaaagcaaaattagctgaaaaaggcgtaattttttgcccaatctctgaagcagtgcat
caataccctgaattgctcatgcaatatttagggtcagttgtttcttatcgagataatttt
tatgctgctttaaattcggctgttttcagtgacggctcctttgtttatattccaaaagga
gtacgttgtcctatggaattatccacctattttcgcattaatgcggcctctacgggacag
tttgagcgcacattaattgttgcagatgtcgatagttatgtgtcttacctagagggatgt
actgcacccatgcgtgacgaaaatcaattgcatgcggctgtggttgaattggtcgcttta
gatggtgctcaaattaaatattcaaccgtacaaaattggtaccctggggataaagaaggt
aaaggtggtatttataattttgtgactaaaagaggggcgtgtcgtggtaaacgttctaaa
atttcttggacgcaaatagaaactggctcagcaattacctggaaatatccaagtgtgatt
ttgcaaggtgatgattccgttggtgagttttattcagttgctttgacaaataattatcaa
caagcagataccggtactaaaatgattcatatcggtaaaaacacgcggtcaacgattatt
tccaaaggaattagtgcgggcaaagcacataatgcttatcgtggcctggtacgtattgcg
cccacggcaattaatgcacgtaattatactcaatgtgattcaatgcttatgggatctgaa
tgttccgcgcacacgttcccttatatagaagttaaaaatccgacggcgcaagtagaacat
gaggccacaacttcaaaaatcagtgaagaacaattgttttattgtcaacaacgcgggatt
gatacagaggatgccgtgtcaatgattgttaatggcttttgtaagcaggtgttaaaagaa
ttgcctatggagtttgcggtggaagcaactaaattattgggcttaagtttagaaggggca
gtaggttag

DBGET integrated database retrieval system