KEGG   Legionella longbeachae: LLO_3074Help
Entry
LLO_3074          CDS       T01183                                 

Gene name
dotU
Definition
(GenBank) Hypothetical protein of unknown function
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: CBJ13525
Pasteur: llo3074
UniProt: D3HM39
Position
3570476..3571261
Genome map
AA seq 261 aa AA seqDB search
MTAEHYPVSLVNNRLDSGTSLIPQGYYRSKLFIAPFSTNALVAAAGPLLSLLERLCLSPS
LPPIENIRDNIEHELLAFQSKMDASKYPMDFIIIAHYLMTATIDELIGKNYMRVYQINAE
FKAFTPLTNGDTQPQYRFFEILNYIKERPNQYLDLIELVYFFLIVGFEGHYHLKPDGRQA
LDNYIDDLYQIIQQNRFHQPRRLFNENPLPKTTKKSYKTVIITMVTAVTLVVFAFFTSQY
LLENKAKSVLFGHSQLALLES
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgagcattatccggtctcgctggtcaacaatcgcctcgactcgggaacttca
cttatcccgcaggggtactatcgttctaaattatttattgcccctttttctactaacgcc
ctggttgcagcagctggccctcttttatcgttattggaaaggctttgtttaagcccttca
ctgcctcctattgaaaatattagagataacattgagcacgaactgcttgcatttcaaagt
aagatggatgcgtccaagtaccctatggatttcattatcattgcccactacttaatgacc
gcgaccatagatgaactcattggtaaaaattacatgcgtgtctatcaaataaatgccgaa
tttaaggcttttacaccactaaccaatggggatactcaacctcaatatcgtttttttgaa
attctaaattacattaaagagcgccccaaccaatatctcgatctcattgaattggtttat
ttttttctaatcgtaggttttgagggtcactatcaccttaaacccgatggacgacaagct
ttagacaactacattgatgacctctatcagataattcagcaaaaccgctttcatcaacca
cggcgtttatttaatgaaaacccgttgcctaaaactactaaaaaaagttataagacagta
ataatcaccatggttactgcggttaccttagtagtctttgctttttttaccagccaatat
ttattggaaaataaagcaaaatcagttttatttggtcactcacaactcgctcttttggag
agctaa

DBGET integrated database retrieval system