KEGG   Legionella longbeachae: LLO_3082Help
Entry
LLO_3082          CDS       T01183                                 

Definition
(GenBank) Similar to eukaryotic proteins, contains 2 mitochondrial carrier protein domains
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llo02000]
    LLO_3082
Transporters [BR:llo02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   LLO_3082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mito_carr EcKinase DUF4149
Motif
Other DBs
NCBI-ProteinID: CBJ13533
Pasteur: llo3082
UniProt: D3HM44
Position
complement(3579353..3580171)
Genome map
AA seq 272 aa AA seqDB search
MGQEKRAQKTLWDAYAFGIGYTIFTTCIGHPAERLKVAIQTNLAQSSYSVIKQFAGLNLK
HFSTGFLSCVIRQLGKVAYRPLLISHMPKEIDKLQLPMLSGGALKGAIASVFDTVVVSPI
ENIKTVQMRTITSHTKPITPFQAMNAIYQQRGLTGFFSGSVPTIGKAFPSWFYLFMTYNA
IKTKREKQTFLSTILWATFASAPVAFATTPLDVLKSQQQAGNKVQQSLGQLASQIYKNHG
TNAFFRGFHCRLVHKSLSTAGAYMILDMAQKM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagagaaaagagcgcaaaagactctttgggatgcttatgcttttggcataggg
tatacaatttttacaacatgtataggccatccggcagaaagattaaaagttgcaattcaa
acaaatcttgctcaaagttcttattcggttataaaacaatttgccggcttgaacttaaag
catttttctacaggatttttatcatgcgtcattcgtcagcttggtaaagtagcatatagg
ccgttattgatttcccatatgccaaaagaaatagataagctacagcttcctatgttatct
ggtggtgcgctaaaaggagctatcgcaagtgtttttgatactgtagttgttagcccaatt
gaaaacatcaaaacagtgcaaatgaggactattacaagtcatactaaacctataacacct
ttccaggcaatgaatgctatttatcaacaaagaggtctgactggttttttttcaggaagt
gttcctacaataggaaaagcttttcctagctggttttatttatttatgacgtacaatgca
attaaaaccaaacgcgaaaaacaaacatttttatcaaccattttgtgggcaacctttgcc
tctgcccctgttgcttttgcaactacccctcttgatgtattgaaaagtcagcaacaagca
ggtaataaagtacaacaatcattagggcagcttgcttctcaaatttataaaaatcatggt
accaatgctttttttagaggatttcattgtcggttagtacataaatcattatctacggct
ggcgcttatatgattctagatatggcgcagaagatgtga

DBGET integrated database retrieval system