KEGG   Legionella longbeachae: LLO_3087Help
Entry
LLO_3087          CDS       T01183                                 

Gene name
greA
Definition
(GenBank) transcription elongation factor GreA
  KO
K03624  transcription elongation factor GreA
Organism
llo  Legionella longbeachae
Brite
Transcription machinery [BR:llo03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     LLO_3087 (greA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB_N GreA_GreB
Motif
Other DBs
NCBI-ProteinID: CBJ13538
Pasteur: llo3087
UniProt: D3HM49
Position
complement(3586919..3587395)
Genome map
AA seq 158 aa AA seqDB search
MSKYPMTVHGAEALKEELHRLKFVDRPRIVDAIATARAHGDLKENAEYHAAREQQSFNEG
RIQELEAKLSHAQIIDISKLPNNGKVVFGCTVTICNVANETQLTYQIVGEDEADIKQNKI
SYSSPIGRGLIGKELDDSVTVNTPGGLVEYEIIDVQYI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatatcctatgacagtacatggtgcagaagcattaaaagaagaattacaccga
ttaaaatttgttgatagacctcgcatcgtggatgcgattgccacggcccgagcacacggt
gatctaaaagaaaatgcggaataccatgccgctcgtgaacagcagagttttaatgaaggc
cgtattcaggagttagaggcaaaattatctcatgctcaaattattgatatcagcaaattg
cccaacaatggcaaagtagtatttggctgtaccgttactatttgtaatgtagctaacgag
acccaattaacttatcaaattgttggtgaagacgaagcagatataaaacaaaataaaatt
tcttacagttcacctattgggcgtggattaattggcaaggaattagatgattctgtaaca
gtaaatacccccggagggttggtagaatacgaaattatcgatgttcaatatatctaa

DBGET integrated database retrieval system