KEGG   Legionella longbeachae: LLO_3088Help
Entry
LLO_3088          CDS       T01183                                 

Gene name
carB
Definition
(GenBank) carbamoyl-phosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
llo  Legionella longbeachae
Pathway
llo00240  Pyrimidine metabolism
llo00250  Alanine, aspartate and glutamate metabolism
llo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LLO_3088 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LLO_3088 (carB)
Enzymes [BR:llo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     LLO_3088 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATPgrasp_Ter ATP-grasp Dala_Dala_lig_C ATP-grasp_3 RimK GARS_A ATP-grasp_4 ATP-grasp_5 ATP-grasp_2 CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CBJ13539
Pasteur: llo3088
UniProt: D3HM50
Position
complement(3587420..3590623)
Genome map
AA seq 1067 aa AA seqDB search
MPKRTDIKSILILGAGPIVIGQACEFDYSGTQAVRALKEEGYRVILVNSNPATIMTDPEL
ADATYIEPVSWKEVARIIEIERPDALLPTMGGQTALNCALDLVREGILAKYHVEMIGATR
EAIDRAEDREKFRQLMLKIGLDMPRSAIAHSMEEAIQVQARLGYPAIIRPSFTMGGSGGG
IAYNREEFEEICMRGLELSPTHELLIDESVLGWKEFEMEVVRDKNDNCIIVCTIENFDPM
GVHTGDSITVAPAQTLTDKEYQRMRDAAIKVLRAVGVDTGGSNVQFAINPEDGRMLVVEM
NPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELKNEITGGKTPAAFEPSIDYVVTKIP
RFNFDKFPQTSDTLTTQMKSVGEVMAIGSNFQESLQKAIRGLEIGRCGLHPLFLKDDFAR
LRGNLREPTPDRLWYIADAFRKNMSLEEIHQESRVDPWFLAQIEELITLERSVTGRALSN
IDATMLRLLKKRGFADAYLAKLWSCTEEEVRKRRKELGVFPVYKRIDSCAGEFPSATAYM
YSCYESSCEANPDLDKKKIMILGGGPNRIGQGIEFDYCCVHAAMALRDAGCQTIMVNCNP
ETVSTDFDTSDRLYFEPVTLEDVLAIVEVEKPDGVIVHYGGQTPLKLARALEANGVKIIG
TSPDAIDRAEDRDRFQKLVTELKLHQPDNGTVRSEEEAIALANKIGYPLVVRPSYVLGGR
AMEVVYQEEDLRHYLSHAVAVSNDSPVLLDKFLNDAIEVDIDAVCDGKEVLIGAVMEHIE
QAGIHSGDSACTLPPFSLSVVVQQDLMEQMRQMALKLGVVGLINAQFAIQADDIYVLEVN
PRASRTVPFVSKATGFPLAKIAALCKLGVSLKEQGLSQNHHMPSFYSIKLPVFPFIKFSG
VDSILGPEMKSTGEVMGIARRFGQAYAKAQLGAGSNIAKRRRAFVSVRDADKTRVGEISK
RLIELGFEIIATRGTALALQAAGVDCRRVFKVNEGRPHVLDFIKNNEIDFIVNTTEGKQA
IADSFAIRRNALQHKVSYTTTLSGAEAACLAMKYEDRETVTRLQDLH
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacgaaccgatattaaatccattctaatccttggggctggtcctatagtcata
ggacaagcttgtgagtttgactattctggcacccaggcagtacgagctctaaaggaagaa
ggatatagagttatcctcgtgaactctaatcctgccactataatgactgatccagagctt
gcagatgcgacctatattgagcctgtttcctggaaagaagtggcacgaattattgaaata
gaacgtcccgatgctcttttgcccaccatgggagggcagaccgcgttgaattgtgcatta
gatctggtgcgtgaagggattttggcaaaatatcatgttgaaatgataggcgctacacga
gaagcaattgatcgtgctgaagatagggagaaatttaggcagctgatgcttaaaattggt
ttggacatgcccagatcagccattgcgcacagcatggaagaagcgatacaggtgcaagca
cgcctgggttatcctgcgatcatccgaccttcatttactatggggggcagcggtggtgga
attgcctataatcgtgaagagtttgaagaaatttgtatgcgcggtttggagctgtcacca
acccatgaattattaatcgatgaatcagtactgggatggaaagaatttgaaatggaagta
gtgcgcgacaaaaatgataactgtattattgtctgtactattgaaaactttgatcctatg
ggagtacatacaggcgattcaattacggttgccccagcacaaaccctcactgataaagaa
taccaacgtatgcgtgatgctgcaatcaaggtgctaagggctgttggcgttgatactgga
ggttccaatgtacaattcgccattaatcctgaagatgggcgcatgcttgttgtagaaatg
aaccccagggtttctcgaagttccgcattagcatccaaggcaacaggttttccaattgca
aaaatcgcagcgaaacttgctgtaggatatactcttgatgaattaaaaaatgaaattact
ggaggtaaaactcctgctgcatttgaaccaagcattgattatgtagtcactaaaatacct
agatttaacttcgataaatttcctcaaacttcggatactttaacgacccaaatgaaatct
gttggtgaggttatggctataggctcaaatttccaggagtccttacaaaaagcgattcgt
gggttagagataggccgttgtggcttgcatcctttgtttttaaaagatgattttgctcgt
ttaagggggaatttgcgtgagcccactccagatagactctggtatattgccgatgctttc
cggaaaaatatgtcccttgaggaaattcaccaggaaagccgggttgatccatggttttta
gcacaaattgaagaattgataaccttagagcgttctgttactggtagggcattaagcaat
attgatgcaacaatgttgcgcttattgaaaaagcgtggttttgcagatgcttatttagcc
aagctttggtcttgtactgaagaagaggttcgcaaaagacgcaaggagttaggtgtcttt
cctgtctataagcgcattgattcttgtgcgggtgaatttcccagcgccacagcatatatg
tattcgtgttatgaaagtagttgtgaggctaatcctgatttagacaagaaaaagattatg
atccttggcggaggccccaatcgaattggtcaaggaattgaatttgattattgctgtgta
catgcggctatggcacttagggacgcaggttgtcagacgattatggttaattgtaacccg
gagacagtctctactgattttgatacatcagatcgcctgtattttgaacctgtgacgtta
gaggatgtattagctattgtcgaagtagaaaaacctgatggagtgattgttcattatggt
ggccaaactcctttaaaattagctcgcgctttagaagctaatggcgtgaaaattatagga
acatccccggatgcaattgatagggcagaagatagggatcgtttccaaaagttagttact
gagttgaaattacaccaacctgacaatggtacagtacggagtgaagaagaggcgattgct
ttggcaaacaagattggatatcccctggttgttaggccatcttatgtgcttggcgggcgc
gcaatggaagttgtttatcaggaagaggatttacgccattatttatcccatgccgtcgct
gtttcaaatgattcgccagtattgttagataagtttttaaatgatgcaattgaagtggat
attgatgcagtttgtgatggcaaggaagtgttaattggtgctgtaatggagcatatagaa
caggcgggtattcattcaggggattctgcttgcactttacctccttttagtcttagtgtt
gttgtgcaacaggacttaatggagcaaatgcgccaaatggcattaaaattgggtgtggtg
ggtttgatcaatgcccaatttgcaattcaggccgatgatatttatgttttagaagttaat
ccaagagcatcacggacggtcccttttgtatctaaagctacagggttccctttagccaaa
attgcagctctttgcaaattaggtgttagtcttaaagagcaagggttgagtcagaatcat
catatgccatcgttttattcaattaagttgccggtttttccgtttattaagttttctgga
gtagattctattcttggcccagaaatgaaatctactggcgaggtaatgggtattgccaga
cggtttggacaggcttatgctaaagcacaattgggcgcgggcagtaatattgctaaacgt
cgtcgcgcttttgtttctgttcgcgatgcggataaaacgcgagtaggagaaatttctaaa
cgcttgattgagttagggtttgaaatcatagcgacgcgaggtacggccttggctttgcaa
gcagcaggagttgactgtcgaagagtgtttaaggtcaatgaaggaagaccacatgtttta
gactttataaagaataatgaaatcgatttcattgttaatacaactgaaggtaaacaagct
attgcagattcctttgcaattaggcgcaatgcattgcaacataaggtgagctacactacc
accttgtcaggtgctgaggctgcttgtcttgcaatgaaatatgaagacagagaaactgta
acacgattacaggacttacattaa

DBGET integrated database retrieval system