KEGG   Legionella longbeachae: LLO_3090Help
Entry
LLO_3090          CDS       T01183                                 

Definition
(GenBank) putative coiled coil protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBJ13541
Pasteur: llo3090
UniProt: D3HM52
Position
complement(3591120..3592313)
Genome map
AA seq 397 aa AA seqDB search
MQHIFMYVLERLLAIFLGIVVLPLRVFVYHVLCAIVALLVGIVVGIGLPLSLALTLNHEG
ISKAANIFLTLFLVFPVIALITTVALVLLTVFILGNALVDMVGVLGLGFINSFLYGMDGF
WNTLSAQQLFSRSIWSPIKAFVGLVLTNQLNSDGEDQRIIDGLQNFEIVHEDLDIPDLQN
KDPLEPPILFEKTELKKIEELIVHLTHLEAYLTQQIREQLTTLKILYIQYKDLFSKLSEV
HLALLSNKKSQIKDELIAYNKVRIPILLVKQYKKGGHWHHVPAASYVTDRESFLHLLKKS
SKHPLNRDLFKKPKPYKQMETRYLWYELTENYCSSQELSDAVVEIRVLMNALLSQLNVIQ
RMNFSIEPFSPAFFGSGTKNNEPSQVVQMEQKNRLQL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatatttttatgtatgttttagaacgccttttagctattttcttaggcatcgtt
gtgttgccattgcgtgtgttcgtatatcatgtattgtgcgccatagttgcactcttagtt
ggaattgttgtcggtattggcttgccgttatcacttgcattgaccctgaatcatgaaggt
atttctaaagccgctaatatattcctgacactttttttggtttttccagtaatcgcattg
ataacaacagtggcccttgttcttttaacggtatttatattgggcaatgctctggttgat
atggttggggtattaggacttggttttataaatagttttctttatgggatggatggtttt
tggaataccctaagcgcgcaacaactctttagtcggtctatctggagtccaattaaagct
tttgtagggcttgtccttacgaatcaattaaatagtgatggtgaagatcaacgaattatt
gatggattgcaaaattttgaaattgtgcatgaagatttagatatccccgatttgcaaaat
aaagacccattagagccgccaattttatttgaaaaaactgaattaaaaaaaattgaagaa
ctcattgttcacttaacacacttggaagcgtatttaacgcaacaaataagagaacaattg
accactttaaaaattttatatattcaatataaagatcttttttccaaattgtcagaagta
catttggcattgttgagtaataaaaaaagtcaaattaaggatgagcttattgcctacaat
aaagtaagaatacctattttattagtgaaacaatataaaaagggggggcactggcatcat
gtccctgctgcaagttatgttacggatagagaaagcttcctgcatttattgaaaaaaagt
tccaagcatcctttaaatagagatctctttaaaaaaccgaagccttacaaacaaatggaa
acaagatatctttggtatgaacttaccgaaaattactgctcttcccaggaattgagtgat
gctgttgtcgaaatccgtgttttaatgaatgcattgttgtctcaattaaatgtaatacaa
agaatgaatttcagcatagagcctttttctccggcattttttggatcaggaactaaaaat
aatgaaccttctcaggtagtgcaaatggagcagaaaaacaggctacagctttga

DBGET integrated database retrieval system