KEGG   Legionella longbeachae: LLO_3273Help
Entry
LLO_3273          CDS       T01183                                 

Gene name
acsB
Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
llo  Legionella longbeachae
Pathway
llo00010  Glycolysis / Gluconeogenesis
llo00620  Pyruvate metabolism
llo00640  Propanoate metabolism
llo00680  Methane metabolism
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
llo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_3273 (acsB)
   00620 Pyruvate metabolism
    LLO_3273 (acsB)
   00640 Propanoate metabolism
    LLO_3273 (acsB)
  Energy metabolism
   00680 Methane metabolism
    LLO_3273 (acsB)
Enzymes [BR:llo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LLO_3273 (acsB)
Lipid biosynthesis proteins [BR:llo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LLO_3273 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBJ13733
Pasteur: llo3273
UniProt: D3HMN7
Position
3842041..3843921
Genome map
AA seq 626 aa AA seqDB search
MHAHLRPPQLAQTEDTLTEFWSEIAQQTLDWLRPWDTVLTGGLQHGDVTWFKGGKLNASL
NCLDRHLPYKANHPAIIWEGDDPDQNKTLTFATLHAEVCRMSNVLKQFNVKKGDKVAIYL
PMIPEAAIAMLACTRIGAVHTVIFAGFSAQALKQRVLASECRCIITANHFYRGGKLVGLK
EHIDEACKDLSLPRIIIKTSNDPVAFDNNKDHWWHELKEKVSDQCDPEPMDAEDPLFILY
TSGSTGQPKGVVHTTAGYLVQTAYTHQLLFNCQDNDIFWCTADVGWVTGHSYLVYGPLCN
GITTLIYEGIPTWPDPSRNWQIIDKYQVNVFYTAPTAIRALMRAGDDWLASSTRSSLRLL
GSVGEPINPEAWQWYYQKVGQKRCPIIDTWWQTETGAIMISPRADEPDSKPGAARQPIPG
VIPVLLNEHGHEITGAGEGYLAIKYPWPSMARTIAGDHHRYCSTYLHHGYYITGDGAKRD
EEGDYWITGRVDDVINVSGHRLGTAEIESALVSHPAVAEAAVVGIPHELKGQGIYAFVIL
RDGFTANDALKTELIKQVNQEISPIAKPDIIHFTHDLPKTRSGKIMRRILRKISGKEIQS
LEELGDISTLANPQIVAQLWEESAQF
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcatgctcatttacgcccccctcaactagcacaaacagaagatactttgactgaattt
tggtcggaaattgcgcaacaaactttggattggctacgcccctgggatacagtattgact
ggtgggttgcaacatggtgatgtgacctggtttaaaggtgggaaactaaacgccagctta
aattgcctggataggcatcttccctataaagcaaatcatcctgcaattatttgggaggga
gatgatccagaccaaaacaagacattaacttttgcaacattacatgctgaagtatgccgc
atgagcaatgtactcaaacaattcaatgtaaaaaaaggggataaagtcgcgatctaccta
ccgatgatccccgaagcagcaatagctatgctcgcttgtacccgaattggcgcagtacat
accgtcatatttgcaggtttttctgcccaggctttaaagcaacgtgtactcgcatcggaa
tgccgctgtatcattacagcaaaccacttttaccgcgggggtaaattagtaggattaaaa
gagcatattgatgaagcgtgcaaggatttatccttacccagaattatcattaaaaccagt
aatgaccctgttgcttttgataacaataaagatcactggtggcatgagttaaaagagaaa
gtaagtgatcaatgcgatcctgagcctatggatgccgaagatcctttatttatcctttat
acctcaggtagtaccggacaacctaaaggggtagttcatactacagcgggttatctggta
caaacagcctacacccatcagttgctctttaattgtcaggataatgacatcttttggtgt
accgctgatgttggctgggttactggtcatagctatttagtgtatggccctctttgcaat
ggcatcaccacgcttatctatgaggggattcctacctggcctgatccttccagaaactgg
caaatcattgataaataccaagtgaatgtcttttataccgcacctactgctatacgcgct
ttaatgcgtgcaggagatgactggctcgcatccagcacccgcagttctttacgcttgctg
ggttcagtaggagaacccattaatccagaagcctggcaatggtattatcagaaagtaggc
caaaagagatgcccaataatagatacttggtggcaaacagaaactggggcgattatgatt
agtcccagagctgatgaaccagacagcaaacctggcgctgcccgccaacccattccgggg
gttattccagtgctactcaatgagcatggccatgaaataaccggagctggtgaaggatac
ctggctataaaatatccatggccatctatggcgcgaaccatcgcaggagatcaccatcgc
tattgtagcacctatttacatcatggttattacatcaccggtgatggcgccaagcgtgac
gaagagggggattattggatcactggccgtgtggatgatgtgattaatgtttctggtcat
cgcttaggtactgcagaaattgaaagtgcgttggtaagccaccctgcagttgcagaagca
gctgttgttgggatacctcatgagttaaagggtcaaggaatttatgcttttgtcatttta
agggatggtttcactgcgaatgatgctttaaaaactgagttaatcaaacaagtgaatcaa
gaaataagccctatagccaaaccagacatcatccattttactcatgacttaccaaaaaca
cgatcaggtaagattatgcggcgaattttgcgcaaaatttcaggaaaagaaattcaaagt
cttgaagaattaggtgatatttcgactttagcaaaccctcagattgttgcgcaattatgg
gaagaatcggcacaattttaa

DBGET integrated database retrieval system