KEGG   Legionella longbeachae: LLO_3307Help
Entry
LLO_3307          CDS       T01183                                 

Definition
(GenBank) putative phosphoglycerate mutase
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ13767
Pasteur: llo3307
UniProt: D3HMS1
Position
3881896..3882534
Genome map
AA seq 212 aa AA seqDB search
MATRLLVARHGNTFAPGDVVRRVGTTDLSLVASGLNQGRLLGVYLKQQHLIPDVIFTSKL
KRAIQTAEQAQLTMGSDLPIETLSIFNEIDYGPDENQPEENVIARIGKDAMSAWETQAIV
PQGWSVDPDTLIKNWLDFSIHLRTNYMGKTCLVITSNGVARFLPHLTGNFAAFTGQYGIK
IATGALCIFENKEHSELWDCIAWNVKPQIMSF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctacacgattacttgtcgcccgtcatggaaacactttcgcccctggcgatgtggtc
cgccgagtaggcactactgatttatctttagtggcaagcggcttaaatcaaggccgttta
cttggtgtttacctaaagcaacagcatcttatccctgatgtgatttttacctcaaaatta
aaacgcgccatccagacagcagaacaagctcagctcactatgggctctgatttgccgatt
gaaaccttgtccattttcaatgaaatcgattatgggcctgatgaaaaccaaccagaagag
aatgtaattgctcgaattggaaaagatgcgatgagcgcttgggaaacccaggctatagta
ccccaaggttggagtgttgatcccgatacactcattaaaaattggctggatttttctatc
catcttcgcacaaattatatggggaaaacatgtttggtcatcaccagtaatggagttgcc
cgttttttacctcatttaacaggtaattttgcagcattcactggacaatatggaattaaa
attgctacaggagcattatgcatctttgaaaataaagaacattctgaactttgggattgt
atcgcctggaatgtaaagccgcagattatgagtttttag

DBGET integrated database retrieval system