KEGG   Legionella longbeachae: LLO_4085Help
Entry
LLO_4085          CDS       T01183                                 

Definition
(GenBank) protein of unknown function
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBJ13524
Pasteur: llo4085
UniProt: D3HM38
Position
complement(3569985..3570143)
Genome map
AA seq 52 aa AA seqDB search
MTVLSVNVREVIETGPLRDENWNLSIILFASFLNNKVLFMFVRYRTDLVLYL
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctttcagttaatgtcagggaggtaatcgaaacgggtccgttgagagatgaa
aattggaatctttcaattattttatttgcatcattccttaacaataaggtactattcatg
ttcgttagatatagaaccgatttagtactatatttatag

DBGET integrated database retrieval system