KEGG   Lactococcus lactis subsp. cremoris A76: llh_4675Help
Entry
llh_4675          CDS       T01965                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00071  Fatty acid degradation
llr00072  Synthesis and degradation of ketone bodies
llr00280  Valine, leucine and isoleucine degradation
llr00362  Benzoate degradation
llr00380  Tryptophan metabolism
llr00620  Pyruvate metabolism
llr00630  Glyoxylate and dicarboxylate metabolism
llr00640  Propanoate metabolism
llr00650  Butanoate metabolism
llr00900  Terpenoid backbone biosynthesis
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01120  Microbial metabolism in diverse environments
llr01130  Biosynthesis of antibiotics
llr01200  Carbon metabolism
llr01212  Fatty acid metabolism
llr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    llh_4675
   00630 Glyoxylate and dicarboxylate metabolism
    llh_4675
   00640 Propanoate metabolism
    llh_4675
   00650 Butanoate metabolism
    llh_4675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    llh_4675
   00072 Synthesis and degradation of ketone bodies
    llh_4675
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    llh_4675
   00310 Lysine degradation
    llh_4675
   00380 Tryptophan metabolism
    llh_4675
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    llh_4675
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    llh_4675
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    llh_4675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llr04147]
    llh_4675
Enzymes [BR:llr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     llh_4675
Exosome [BR:llr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   llh_4675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEU40111
UniProt: G8P8H7
Position
893247..894386
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIFGNVLQAG
NGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQNSQEKAV
AASQAGIFNDEIVALGKLSVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
LILATKEYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLLEIDLFEI
NEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKREQKRYGIA
SLCIGGGLGLAILLKNPDF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagtcggaaaatatgatggtgct
cttgctgagtattcggcagaaaagcttggaacacacgttgtttcagctttattgtcaaaa
aataaaaatataaaatcagatgttgaacaagttatttttggtaatgttcttcaagctggt
aatggtcaaaatattgcgcgccaaattgcgattaatagtggtttatcaaccagtgttcca
gcttcaaccattaatgaagtttgtggttcagggatgaaggcagtaattctagctaagcaa
cttttacagttgggcgaagcagaagttgttattgctggtggaacggaatcaatgtctaat
gcgcctattcttaaaaatcgtaaaactgaagaagaaacattaagcatgttaagtgacggc
ttaattgatgctttttctggcatttcaatgggaattattggagaaacaattgcggagcag
tttgatgttagtcgtgctgaccaagacctattcgcacaaaattctcaagagaaggcagta
gcagccagtcaagcaggaatttttaatgacgagatcgtagctcttgggaaactttctgtt
gatgaaactcctcgaccttcatctagcctagaaaaattggctacattacggacagccttt
aaggaaaatggaacagttacagctgggaattcttcaccagttaatgacggagcttctgct
ttaattttggccactaaagagtatgctgaaaaacatggaatatcttatttagctgaatta
gttgagagtgcggaagttggtattgaccctgcaattatgggagtatcaccgattgatgca
attcaaaaattagttcaacgctcaggcgttcagcttttagaaatagatctttttgaaatt
aatgaggcctttgctgcatcaagtattgctgttaatcgtgaattgggcttaaaagattct
caagttaatatttatggaggagcgattgctcttggacatgctattgggtcaagtggtgcc
aaaatcctgacaactttgggatatgctttgaaacgagaacaaaagcgttatggaattgct
agtctttgtattggcggtggtctagggcttgctattttattgaaaaatcctgacttttaa

DBGET integrated database retrieval system