KEGG   Lactococcus lactis subsp. cremoris A76: llh_5490Help
Entry
llh_5490          CDS       T01965                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01130  Biosynthesis of antibiotics
llr01230  Biosynthesis of amino acids
Module
llr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    llh_5490
Enzymes [BR:llr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     llh_5490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Polysacc_deac_2 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEU40274
UniProt: G8P9E1
Position
1025059..1025853
Genome map
AA seq 264 aa AA seqDB search
MNIKEGKFLETILAEKKQEIAQMPDENSKPIRQTYRLYDYLKKHSDQLQVIAEVKKASPS
LGDINLEVDIIAQAKNYEQAGAAMISVLTDPVFFKGNIEYLREISKNVQIPTLNKDFIID
KKQINRALNAGATVILLIVACFENDFEKLEELYNYAISLGLEVLVETHNKAELDRAHQLA
AKIIGVNNRNLKTFEVSLQNSTDLVPYFKEENVYISESGIFGKKEAQKVAENFNGILVGT
ALMQANNLTKSLTDLKIKRKNDEH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaagaaggaaaattcttagaaacaattttagcagaaaaaaaacaagagata
gctcaaatgcctgacgaaaattccaaaccaattcgtcaaacttatagattatatgattac
ctaaaaaaacattctgatcaacttcaagtcattgccgaagtaaaaaaagcttcgccaagt
cttggagatatcaatctcgaagtagacattatcgcccaagccaaaaattatgaacaagct
ggggctgccatgatttccgttctaactgaccctgtattctttaaaggaaacattgaatac
ctccgtgaaatatctaaaaatgttcaaattccaacacttaacaaagattttatcattgat
aaaaagcaaattaatcgagcactcaatgctggtgcaactgttattttattgattgtcgct
tgttttgaaaatgactttgaaaaattagaagaactctacaattatgcaatttcactagga
cttgaagttttagtcgaaacgcataataaggccgaactcgacagagcccatcaacttgct
gctaaaattattggggtcaataatcgtaatctaaagaccttcgaagtgagcttacaaaac
tcaacagatttggttccttattttaaagaagagaatgtttatatttctgaatcaggtatt
ttcggtaaaaaagaggcacaaaaagttgctgaaaatttcaatggaattttggttggaaca
gcactgatgcaagcaaataatctcacaaaatcactgacagatttaaaaatcaaaaggaaa
aatgatgaacattaa

DBGET integrated database retrieval system