KEGG   Lactococcus lactis subsp. cremoris A76: llh_6320Help
Entry
llh_6320          CDS       T01965                                 

Definition
(GenBank) putative NagD-like phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00627  Aminobenzoate degradation
llr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    llh_6320
Enzymes [BR:llr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     llh_6320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AEU40440
UniProt: G8P2V6
Position
1173133..1173906
Genome map
AA seq 257 aa AA seqDB search
MTNKKYGGYLIDLDGTIYLGNKRIPAGENFIHRLQEAKIPYLLVTNNTTKTPRVVQKRLS
QHFNIETPLETIYTASLATVDYMNDLGLEKTVYIIGEDGLKEAIYEAGYKKDRENPAYVV
VALDTDLTYEMLVLATLAIHKGAKFIGTNPDLNLPNERGLTPGAGALIKMLEAATRVEAT
IIGKPEAIIADKAVEKLGLPKSDLLMVGDNYLTDIHTGINNGIDSLLVTTGFTKAEEVPN
LPVPPTYVVSSLNDWEV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaaaatatggtggttacttgattgaccttgatggaacaatttacttaggt
aataaacggattcctgccggtgaaaatttcattcaccgtctgcaagaagccaaaatacct
tatcttttagtgactaataacaccactaagacaccgcgcgtggttcaaaaacgtttgagt
cagcactttaatattgagactccacttgaaacaatttatactgcaagtctagcaactgtt
gattatatgaacgatttgggtttagaaaaaacagtctatattattggtgaagatggacta
aaagaggcaatctatgaagctggttataaaaaagaccgtgaaaatccagcttatgttgtt
gttgctttagatactgatttaacttatgaaatgttggttttggcgacgcttgccattcat
aagggggcaaaatttattggaacaaatccagatttaaacttaccaaatgaacgtggtttg
actcccggtgctggagcattgattaaaatgcttgaagcggcaacacgagttgaagcgaca
attattgggaaacctgaagcaattattgctgacaaagccgttgaaaaactcggacttcct
aagtcagacttattgatggtcggagataattatctgacagatattcatacaggaattaat
aatggtattgatagtctacttgtgacgacaggatttaccaaagctgaagaagtaccaaac
cttccagttccaccaacttatgtggtgtctagtttaaacgattgggaagtctaa

DBGET integrated database retrieval system