KEGG   Lactococcus lactis subsp. cremoris A76: llh_7095Help
Entry
llh_7095          CDS       T01965                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00471  D-Glutamine and D-glutamate metabolism
llr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    llh_7095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:llr01011]
    llh_7095
Enzymes [BR:llr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     llh_7095
Peptidoglycan biosynthesis and degradation proteins [BR:llr01011]
 Precursor biosynthesis
  Racemase
   llh_7095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEU40595
UniProt: G8P466
Position
complement(1317235..1318050)
Genome map
AA seq 271 aa AA seqDB search
MDNRPIGLLDSGVGGLTVARELLRQLPNEEIVYIGDTRRAPYGPRSREQIIAFTWDMVNF
LLSKNVKMIVMACNTATAMTLEIVKEELDIPVIGVILPGASSAIQKTKTNKIGVIATQAS
IRSDEYHKTIARKSSAIEVLSLACPKFVSIVESNEMESEIAKRVVSESLAPLVGKIDTLI
LGCTHYPLLRSLIQETMGKEVRLIDSGAEAVRDISVLLNYFEINAHERKEYQHCFYTTAG
VNSFREIAEKWLNIGHLHIEHAEIENFNKEK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcgaccaatcggcctcttggattctggtgttggtggactgactgttgctcgc
gaactccttaggcaactcccaaatgaagaaattgtctatattggagatacaagaagggct
ccttatggcccgcgcagtcgtgaacaaatcattgcgtttacttgggatatggtcaatttt
ttactttcaaaaaatgtaaaaatgatcgtcatggcctgtaacacagctacggcgatgact
ttggaaatcgtcaaagaagaattggatattccagtgattggggttattttacctggggca
agctcagccatccaaaaaacgaaaacaaacaaaattggagtgattgctacccaagcatcc
atccgttcagatgaatatcataaaacaattgctcgcaaatcgtcagctattgaagtctta
agtcttgcctgccctaagtttgtttcaattgttgaatcaaatgaaatggaatctgaaatt
gctaaaagagtggtctcagaaagtttggctccactggttggaaaaatagatacattaatt
ctaggctgcacacactacccacttttacgttccttgattcaagaaacaatggggaaagaa
gttcgtttgattgattcaggtgcggaagcagtacgagatatttcagttttgttgaactat
ttcgaaatcaatgctcacgagcgcaaggaatatcagcactgtttttatacaacagcaggg
gtcaattcttttcgagaaattgcagaaaaatggttaaatataggacatcttcatattgaa
catgccgaaatagagaatttcaataaggaaaaataa

DBGET integrated database retrieval system