KEGG   Lactococcus lactis subsp. cremoris A76: llh_8165Help
Entry
llh_8165          CDS       T01965                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    llh_8165
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     llh_8165
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     llh_8165
    1.1.1.-  
     llh_8165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C HI0933_like Pyr_redox_2 ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C Pyr_redox 3HCDH_N NAD_binding_8 FAD_binding_2 DAO UDPG_MGDP_dh_N XdhC_C FAD_oxidored RrnaAD NAD_binding_7 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEU40809
UniProt: G8P587
Position
complement(1526129..1526719)
Genome map
AA seq 196 aa AA seqDB search
MGYHAVERANLSEKSTVLVVGAGPIGLLTAAVAKAQGHTVIISEPSGLRRKKAQEAEVAD
YFFNPIEDDIQAKVHQINEKGVDAAFECTSVQPGFDACLDSIRMGGTVVIVAIWGKAASV
DMAKLVIKEANLLGTIAYNNTHPKTIDLVATGKIKLNQFITGKIGLDDLIDKGFDTLIHH
NETAVKTLVSPTGKGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgggatatcatgctgttgaacgtgccaatttgagtgaaaagagtacggtactcgttgtt
ggagctggtccaatcggacttttgacagctgcagttgccaaagctcaagggcatacagta
attattagtgagcctagtggtttgcgtcgtaaaaaagctcaagaagcagaagttgctgat
tatttctttaatccaattgaagatgatattcaggcaaaagttcatcaaattaatgaaaaa
ggagttgatgctgcttttgaatgtacttctgttcaaccaggatttgatgcgtgtttagat
tctattcgcatgggtggaacagttgttatcgttgcaatttggggtaaagcagctagtgtt
gacatggcaaaattagtcattaaagaagctaatcttttagggactattgcttataataat
actcatcctaaaaccattgatttagttgcaactggtaagattaaattgaatcaatttatt
acaggtaaaattggcttagatgacctgattgataaaggttttgatactttgattcatcac
aatgaaacagcagttaagactttagtttcaccaactggaaaaggtctataa

DBGET integrated database retrieval system