KEGG   Lactococcus lactis subsp. cremoris A76: llh_8170Help
Entry
llh_8170          CDS       T01965                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    llh_8170
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     llh_8170
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     llh_8170
    1.1.1.-  
     llh_8170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-ProteinID: AEU40810
UniProt: G8P588
Position
complement(1526780..1527199)
Genome map
AA seq 139 aa AA seqDB search
MRAARFYDRGDIRVEEINEPAVKTGQVGIDVAWCGICGTDLHEFLDGPIFCPSAEHPNPI
TGEVPPVTLGHEMSGIVNFVGQGVSGLKVGDHVVVEPYIVPEGTDTSETGHYNLSEGSNF
IGLGGNGGGLAEKISVDER
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgtttttatgatcgcggagatattcgcgttgaagaaattaatgaacca
gcagtaaaaactggtcaagtaggtatagatgtggcttggtgtggaatctgtggtacagat
ctgcacgaatttttagatggaccaattttttgtccatcagcagaacatccaaatcctatt
acaggtgaagttccaccagttactctcggacacgaaatgtctggtattgtaaactttgta
ggtcaaggggtaagtggtctcaaagtaggtgaccatgttgttgttgaaccttatatcgtt
cccgaaggtactgatacaagtgaaactggacattacaatctctcagaaggatcaaacttt
attggtttgggcggaaatggcggcggtctggctgaaaaaatttcagttgatgaacgttga

DBGET integrated database retrieval system