KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0847Help
Entry
lilo_0847         CDS       T02485                                 

Gene name
butB
Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    lilo_0847 (butB)
Enzymes [BR:lls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     lilo_0847 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     lilo_0847 (butB)
    1.1.1.-  
     lilo_0847 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C HI0933_like Pyr_redox_2 FAD_binding_3 AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N DAO NAD_binding_8 UDPG_MGDP_dh_N FAD_binding_2 Pyr_redox_3 RrnaAD Pyr_redox FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: BAL50847
UniProt: H5SYD3
Position
912473..913543
Genome map
AA seq 356 aa AA seqDB search
MRAARFYDRGDIRVDEINEPIIKAGQVGIDVAWCGICGTDLHEFLDGPIFCPSAEHPNPI
TGEVPPVTLGHEMSGVVNFIGEGVSGLKVGDHVVVEPYIVPEGTDTSETGHYNLSEGSNF
IGLGGNGGGLAEKISVDERWVHKIPDNLPLDEAALIEPLSVGYHAVERANLSEKSTVLVV
GAGPIGLLTAAVAKAQGHTVIISEPSGLRRKKAQEAQVADYFFNPIEDDIQAKVHEINEK
GVDAAFECTSVQPGFDACLDAIRMGGTVVIVAIWGKPASVDMAKLVIKEANLLGTIAYNN
THPKTIDLVSTGKIKLDQFITAKIGLDDLIDKGFDTLIHHNETAVKILVSPTGKGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgtttttacgaccgcggggatatccgcgttgatgaaattaatgaacca
ataataaaagctggtcaagttggcattgatgtggcttggtgtggaatttgtggaacagat
cttcatgaatttttagatggcccaattttttgtccgtcagcagaacatcctaatccaatt
actggagaagtaccaccagtcactcttggacatgaaatgtctggggttgtaaattttata
ggtgaaggagtaagcggacttaaagtaggtgaccatgtcgttgtcgaaccttatatcgtt
cccgaaggtactgatacaagtgaaactggacattataacctctcagaaggttcaaacttt
attggtttgggtggaaatggcggaggtttggctgaaaaaatttctgttgatgaacgttgg
gttcacaaaattcctgataacttacctttggatgaagccgctctaattgagccactatca
gttggctatcacgctgttgaacgagcaaatttaagtgaaaagagtacggtattagttgtt
ggtgctggaccaattggactattaactgctgccgttgcaaaagcgcaaggacatactgtt
atcatcagtgaacctagtggacttcgccgcaaaaaagcacaagaagcacaagttgctgat
tatttcttcaatccaattgaagatgacattcaagctaaagttcatgaaattaatgaaaaa
ggagtggacgcagcctttgaatgtacctctgtccaaccgggatttgacgcttgtctagat
gcgattcgtatgggtggaacagttgtcattgttgcaatttggggcaagcctgctagtgtt
gatatggcaaaattagtaatcaaagaggctaaccttttaggaacgattgcttataataac
actcatccaaaaacaattgatttagtatcaacaggtaaaataaaattggaccaattcatc
acagctaaaatcggtttggatgatttgattgataaaggatttgatacgctgattcatcat
aatgaaacagctgttaaaattttagtttcacccactggtaaaggtctataa

DBGET integrated database retrieval system