KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0997Help
Entry
lilo_0997         CDS       T02485                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lls00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    lilo_0997 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lls01007]
    lilo_0997 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lls03016]
    lilo_0997 (glyQ)
Enzymes [BR:lls01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     lilo_0997 (glyQ)
Amino acid related enzymes [BR:lls01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   lilo_0997 (glyQ)
Transfer RNA biogenesis [BR:lls03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    lilo_0997 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: BAL50996
UniProt: H5SYT2
Position
1060226..1061179
Genome map
AA seq 317 aa AA seqDB search
MANKKLAFQDIILTLQGFWSKQGANLMQAYDNEVGAGTMSPYTFLRSNGPEPWGAAYVQP
SRRPADGRYGENPNRLFQHHQFQVVLKPSPKNIQELYLQSLAELGIDALEHDIRFVEDNW
ENPSMGCAGIGWEVWIDGQECTQFTYFQQVGGIEVDSVTSEITYGLERIATVIQEVDSVY
DLEWGNGVAYGDIFKEPEYEHSKFAFEESNQELLLKLFGEYEQEALDLLDKGLVHPAYDY
ILKSSHTFNLLDARGAVSVTERAGYMHRVRTMARKVAKTFIEERAKLGFPLLKDEALREK
YLGKKGKYTKIVEGEEK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaaaactagcatttcaagatattatcttgaccctacaaggcttttggtct
aaacaaggggcaaacttgatgcaagcttatgataatgaagtaggagcaggaacaatgagc
ccttacactttcttgcgttcaaacggacctgaaccttggggagccgcctatgtgcaacct
tcacgtcgtcctgctgacggtcgttatggtgaaaacccaaatcggttgttccaacaccac
caattccaagttgtattaaaaccatctccaaaaaatatccaagaactttatcttcaaagt
ttagctgaacttggaattgatgctttagaacatgacattcgctttgttgaagataactgg
gaaaatccttcaatgggatgtgccggtattggatgggaagtttggattgatgggcaagaa
tgtactcaatttacttatttccaacaagttggaggaatagaagttgattccgtaacttca
gaaatcacttatggtttggaacgtattgcgacagttattcaagaggttgattctgtttat
gaccttgaatgggggaatggcgtagcttacggagatattttcaaagaacctgaatacgaa
cattctaaatttgcctttgaagaatcaaaccaagagcttttacttaaactttttggagaa
tatgaacaagaagcgcttgatttattagataaaggcttggttcacccagcttatgattat
attttgaaatcttcacataccttcaatttacttgatgcacgtggagcagtttctgtaact
gagcgtgcaggctatatgcatcgcgttcgtacaatggcacgtaaggtagcaaaaactttc
attgaagaacgtgcaaaacttggtttcccgctcttaaaagatgaagcgttgcgtgaaaaa
taccttggtaaaaaaggaaaatatactaagattgtagaaggagaagaaaaataa

DBGET integrated database retrieval system