KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_1438Help
Entry
lilo_1438         CDS       T02485                                 

Gene name
ypfF
Definition
(GenBank) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00625  Chloroalkane and chloroalkene degradation
lls01100  Metabolic pathways
lls01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lls00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lilo_1438 (ypfF)
   00361 Chlorocyclohexane and chlorobenzene degradation
    lilo_1438 (ypfF)
Enzymes [BR:lls01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     lilo_1438 (ypfF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: BAL51435
UniProt: H5T021
Position
complement(1580286..1580981)
Genome map
AA seq 231 aa AA seqDB search
MTVLLFDIDNTLLDFDKAEYDALGKIFTHYQIEDNQENRATYSRENKALWRLHESEKLSR
EELLSTRFDHAFRALNVSVNYNPVAVDDEYQLYLSQGHELIKHAKELLTELSAKGAEMYV
VSNGTSRVSRPRIFESGISDHFREIFISEEVGHHKPSLAFFDYVFDHIEAANQKEFTIVG
DSLATDILGGNRAGIKTIWYNPKQLEVSGEAQPDVQIQDLLEIPTLIKAGN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgactgtactactttttgatattgataacaccttacttgattttgataaagcagaatat
gatgctttgggaaaaatttttacccactatcaaattgaagataatcaggaaaatcgtgcg
acttactctcgtgaaaacaaagcgctttggcgtttacacgaatcagaaaaactttcacga
gaagaacttctatctactcgatttgaccatgcttttagagctttaaatgtgtcagtaaat
tataatccagttgctgttgatgatgaatatcaactttacttatcacaaggtcatgagctg
attaaacatgccaaagaattactgacagagctgtcagcaaaaggagcagaaatgtatgtg
gttagtaatggaacatcacgtgtttctcgcccacgaatttttgagtctggaatctctgac
cactttagagaaatctttattagtgaagaagtgggtcatcataagccttctcttgctttc
ttcgattacgtctttgaccacattgaagcggccaatcaaaaagaatttacaatcgttggc
gactccctagcaactgatattttaggagggaatagagctggaataaagacaatttggtat
aatccaaaacaattggaagttagtggagaagcacaaccagatgtgcaaatccaagatttg
ctagaaattccaacattaataaaagctggtaattaa

DBGET integrated database retrieval system