KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_1495Help
Entry
lilo_1495         CDS       T02485                                 

Gene name
thiL
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00071  Fatty acid degradation
lls00072  Synthesis and degradation of ketone bodies
lls00280  Valine, leucine and isoleucine degradation
lls00362  Benzoate degradation
lls00380  Tryptophan metabolism
lls00620  Pyruvate metabolism
lls00630  Glyoxylate and dicarboxylate metabolism
lls00640  Propanoate metabolism
lls00650  Butanoate metabolism
lls00900  Terpenoid backbone biosynthesis
lls01100  Metabolic pathways
lls01110  Biosynthesis of secondary metabolites
lls01120  Microbial metabolism in diverse environments
lls01130  Biosynthesis of antibiotics
lls01200  Carbon metabolism
lls01212  Fatty acid metabolism
lls02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lilo_1495 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    lilo_1495 (thiL)
   00640 Propanoate metabolism
    lilo_1495 (thiL)
   00650 Butanoate metabolism
    lilo_1495 (thiL)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lilo_1495 (thiL)
   00072 Synthesis and degradation of ketone bodies
    lilo_1495 (thiL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lilo_1495 (thiL)
   00310 Lysine degradation
    lilo_1495 (thiL)
   00380 Tryptophan metabolism
    lilo_1495 (thiL)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lilo_1495 (thiL)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lilo_1495 (thiL)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lilo_1495 (thiL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lls04147]
    lilo_1495 (thiL)
Enzymes [BR:lls01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lilo_1495 (thiL)
Exosome [BR:lls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lilo_1495 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Nab2
Motif
Other DBs
NCBI-ProteinID: BAL51492
UniProt: H5T078
Position
complement(1637242..1638381)
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGRYDGALAEYSAAELGTHVVSNLLSKHENIKSDVEQVIFGNVLQAG
NGQNIARQIAIHSGLSNTVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APIIKNRKTQEETLSMLNDGLVDAFSGISMGIIGETIAEQFDISRADQDAFAQNSQEKAV
AASQAGIFKEEIVAIGEVGVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
VILATKDYAEKHGIPYLAELVDSTEVGIDPAIMGVSPIEAIKKLINRSELELSDIDLFEI
NEAFAASSLAVNRELGLNESQVNIYGGAIALGHAIGSSGSKILTTLSYALKREQKRYGIA
SLCIGGGLGLAVLLKNPNL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagttggaagatacgacggtgct
cttgctgaatattcagcagcagaacttggaacacatgttgtttcaaacttattgtcaaaa
catgaaaatataaaatcagatgttgaacaagttatttttggaaatgttcttcaagctggt
aatggtcaaaatatagcacgtcaaattgcgattcatagtggtttatctaatacagtgccg
gcttcaacaatcaacgaagtttgtggttcaggaatgaaagcagtgattttagccaaacaa
cttttacagcttggtgaagcagaagttgtaatcgctggtgggacagaatctatgtctaat
gccccaattataaagaatcgaaaaactcaagaagaaacattaagtatgttaaatgatggc
ttagttgatgccttctcaggaatttctatgggaattattggtgaaactattgctgagcaa
tttgatataagtcgagcagaccaagacgcttttgcacaaaactctcaagaaaaagcggtc
gctgcaagtcaagctggaatttttaaagaagagattgttgcgattggagaagtcggagtc
gacgaaacaccacgtccttcttctagtttagaaaaattagccactttaaggacagctttc
aaagaaaatggaactgtgacagcaggtaattcttctcctgttaatgatggagcttcagct
gtcattcttgcaacaaaagactatgctgaaaaacatgggattccgtacctagcagaatta
gttgatagtacagaagttggaattgaccctgctattatgggagtttcaccaattgaagct
atcaaaaaattaattaatcgttcagagcttgaactttcagatattgacctgtttgaaatt
aatgaagcatttgcagcatcaagccttgctgtcaatcgtgaacttggtttaaatgaatca
caagttaacatttatggtggtgcaattgcactaggtcatgctatcggttcaagtggttct
aaaattctcacgactttgtcttatgccttaaaacgtgagcaaaaacgctatggaattgct
agtctttgtatcggtggaggcctaggtttggctgttcttttaaaaaatcctaacctttaa

DBGET integrated database retrieval system