KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_1766Help
Entry
lilo_1766         CDS       T02485                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00071  Fatty acid degradation
lls00072  Synthesis and degradation of ketone bodies
lls00280  Valine, leucine and isoleucine degradation
lls00362  Benzoate degradation
lls00380  Tryptophan metabolism
lls00620  Pyruvate metabolism
lls00630  Glyoxylate and dicarboxylate metabolism
lls00640  Propanoate metabolism
lls00650  Butanoate metabolism
lls00900  Terpenoid backbone biosynthesis
lls01100  Metabolic pathways
lls01110  Biosynthesis of secondary metabolites
lls01120  Microbial metabolism in diverse environments
lls01130  Biosynthesis of antibiotics
lls01200  Carbon metabolism
lls01212  Fatty acid metabolism
lls02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    lilo_1766 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    lilo_1766 (fadA)
   00640 Propanoate metabolism
    lilo_1766 (fadA)
   00650 Butanoate metabolism
    lilo_1766 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    lilo_1766 (fadA)
   00072 Synthesis and degradation of ketone bodies
    lilo_1766 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lilo_1766 (fadA)
   00310 Lysine degradation
    lilo_1766 (fadA)
   00380 Tryptophan metabolism
    lilo_1766 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lilo_1766 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lilo_1766 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    lilo_1766 (fadA)
Enzymes [BR:lls01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lilo_1766 (fadA)
Exosome [BR:lls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lilo_1766 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAL51763
UniProt: H5T0Z9
Position
1918686..1919834
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNPLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASIICTGGVEST
SQANIMLDSESYQPIKRFKMAPEPYEDFDMGTLADMTALKYNIPRSVQDLYALNSHKKAT
QAIEGKLLENEVFPYQDEEFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIEL
NEAFASQAILFQNYFKLDDIKLNAYGGALAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISILIGNHWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgttggtatcatagcagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacag
tttaataaaaatccacttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaatcaaggaggaaatttagctcgacgttgtgccttaaaagcaggattttctagccag
gtcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaactacattatttctggcgaagcttccattatttgtacaggaggggtagaaagcaca
tctcaagccaatattatgcttgattcagagagttatcagccgattaaacgatttaaaatg
gctcctgaaccctatgaagatttcgacatgggaacacttgccgatatgacagccctaaaa
tacaatattcctcgtagtgttcaagacctttacgctctaaatagtcataaaaaagcgact
caagctattgaaggaaaacttttagaaaatgaagtttttccctatcaagatgaagaattt
acaataagtagcgatcaaactgttcgtcctaaatcctcaatggaagctttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgcccaataaacgat
ggtgcttcttcaatcatattgtcatccactaataatccttttgattttcaaggctattat
ttaggacaaacaactattgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaatttaaccttaaacttaatgatattgaggctatcgaatta
aatgaagcctttgccagtcaggccattttattccaaaattattttaagcttgatgatata
aaattaaatgcttatggtggtgcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaaccaagtgcaaaaaccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtatactgataggtaatcactggtat
caaaaatga

DBGET integrated database retrieval system