KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_2025Help
Entry
lilo_2025         CDS       T02485                                 

Gene name
arcB
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00220  Arginine biosynthesis
lls01100  Metabolic pathways
lls01110  Biosynthesis of secondary metabolites
lls01130  Biosynthesis of antibiotics
lls01230  Biosynthesis of amino acids
Module
lls_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:lls00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    lilo_2025 (arcB)
Enzymes [BR:lls01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     lilo_2025 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BAL52021
UniProt: H5T1Q7
Position
complement(2184252..2185316)
Genome map
AA seq 354 aa AA seqDB search
MTSPLITKAEVNSVFQGRSLLAEKDFTPAEINYLVDFGLHLKALKQQNIPHHYLEGKNIA
LLFAKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGIKESTEDTARVLGSMFDAIERRGF
SQKEVEDLAKYSGVPVWNGLTDDWHPTQMIADFMTVKENFGHLKGLTLVYVGDGRNNMAN
SLIVTGSMLGVNVHIVAPDSLHPTKEVMDIANKFAEKSGAKPLATSNIEEGVKGANIIYS
DVWVSMGESNWEERVKLLTPYRITMDMLKMTGNADNGQLIFMHCLPAFHDTETEYGKEIK
EKYGLTEMEVTDEVFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPAVPEDFK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaccacttattacaaaagcagaagtaaactcagtattccaaggtcgcagctta
cttgctgaaaaagatttcacaccagctgaaattaactaccttgttgattttggtcttcat
ttgaaagcattgaaacaacaaaatattcctcaccactaccttgaaggtaaaaatattgcc
ttgctctttgcaaaaacttcaactcgtacacgtgctgcctttacaactgctgcaattgac
cttggggctcatccagaataccttggagctaacgatattcaattgggaattaaagaatca
acagaagatacagctcgcgtgcttggttcaatgtttgatgctatcgaacgtcgtggattc
tctcaaaaagaagttgaagatttggcaaaatactctggtgttccagtttggaatggtttg
acagatgattggcatccaacacaaatgattgcagactttatgactgttaaagaaaacttt
ggacatcttaaaggtttgacattagtctacgtaggtgatggtcgtaacaacatggcaaac
tcacttatcgtaactggttctatgcttggtgtgaatgttcatattgttgctccagattca
cttcatcctactaaagaagttatggacattgcaaataaatttgctgaaaaatcaggtgct
aaacctcttgcaacttcaaatattgaagaaggtgttaaaggcgcaaacattatttactca
gacgtttgggtatcaatgggagaatctaactgggaagaacgtgttaaacttttgactcca
taccgtatcacaatggatatgcttaaaatgactggaaatgctgacaatggtcaattgatc
tttatgcactgcttaccagcattccatgatactgaaactgaatatggtaaagaaatcaaa
gaaaaatatggtttgacagaaatggaagtgactgacgaagtattccgttctaaatatgct
cgacaatttgaagaagcagaaaatcgtatgcactctatcaaagcaatcatggctgcaact
ttgggtaatttatttatcccagcagttcctgaagattttaaataa

DBGET integrated database retrieval system