KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0321Help
Entry
CVCAS_0321        CDS       T01964                                 

Gene name
pmg
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00010  Glycolysis / Gluconeogenesis
llt00260  Glycine, serine and threonine metabolism
llt00680  Methane metabolism
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
llt01120  Microbial metabolism in diverse environments
llt01130  Biosynthesis of antibiotics
llt01200  Carbon metabolism
llt01230  Biosynthesis of amino acids
Module
llt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
llt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_0321 (pmg)
  Energy metabolism
   00680 Methane metabolism
    CVCAS_0321 (pmg)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVCAS_0321 (pmg)
Enzymes [BR:llt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CVCAS_0321 (pmg)
Membrane trafficking [BR:llt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CVCAS_0321 (pmg)
Exosome [BR:llt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CVCAS_0321 (pmg)
  Exosomal proteins of melanoma cells
   CVCAS_0321 (pmg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADZ62986
Position
322323..323024
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEYSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcttacacttcagtattgaaacgt
gctatcaaaacaactaaccttgctcttgaatattcagaccaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccaccagcaatggatcatgatgataaatatacagctcacggagaccgtcgttacgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgtgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaatccgtgcactcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaacttg
aacgttcaaaacgaatactacttggctcctaaaaaagcataa

DBGET integrated database retrieval system