KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0961Help
Entry
CVCAS_0961        CDS       T01964                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00740  Riboflavin metabolism
llt00790  Folate biosynthesis
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
Module
llt_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:llt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CVCAS_0961 (ribA)
   00790 Folate biosynthesis
    CVCAS_0961 (ribA)
Enzymes [BR:llt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CVCAS_0961 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CVCAS_0961 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ADZ63610
Position
1006952..1008148
Genome map
AA seq 398 aa AA seqDB search
MFQYNKVEEALAALKAGEMIIVSDDENRENEGDLICAAEFISPEIINFMVSEAKGLICAP
LSETYAKNLQLEAMVEKNTDNHGTAFTVSVDHIETSTGISAFERALTIKKLVDAESLPSD
FRRPGHVFPLIAKKNGLFERNGHTEATVDLLRLAGLKEVGVCVEIMDEDGTMMHKEKLKE
KAQEWGLKYITIKAIQEYLKQNELQVEQVTRAKLPTKYGMFDILGFVNKINGEHHVALVK
GDIGDGQAILCRVHSECLTSDAFGSLKCDCGGQLEEALKKINDEGRGVLLYLRQEGRGIG
LINKLRAYSLQDEGLDTVEANLALGFEEDEREYSIGAQILKIIGVKSLKLMTNNPQKIND
FQKYGLVVEERVALQIKDNPFDLDYLKVKQNKMGHLFD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttccaatataataaagtagaagaagcacttgctgcacttaaagcaggggaaatgatt
atcgttagtgacgatgaaaatagagaaaatgagggcgaccttatctgtgcggccgaattt
atcagtccagaaataattaattttatggtaagtgaggccaaaggattgatatgcgcacca
ctcagtgaaacttatgctaagaatttacaattagaagcaatggtagagaaaaatacagat
aatcatggaacagcttttacagtttcggttgatcatattgaaactagcacaggaatttcg
gcttttgaacgggccttaaccataaaaaaacttgttgatgccgagagtttaccaagtgat
tttcgtagaccaggtcatgtatttccacttattgccaagaaaaatggtctttttgagcga
aatggtcatactgaggctacggttgacttgttgcgtctggctggtttaaaagaagtaggt
gtctgcgttgaaataatggacgaagatggaacaatgatgcataaggagaaactgaaggaa
aaagcgcaagagtggggcttgaaatatatcacaattaaagctattcaagagtatcttaag
caaaatgaactacaagtagaacaggtgactagagctaaactaccgacgaaatatggtatg
tttgatattttaggatttgtcaataaaataaatggtgagcaccatgttgctttagttaaa
ggagatattggtgacggtcaagctattctttgccgcgttcactcagaatgcttaactagt
gatgcttttggttctttgaaatgtgactgcggtggacaattagaagaagcattaaaaaaa
ataaatgatgaggggcgtggcgtgcttttatatcttcgacaagaaggacgtggaattggt
ttgattaataaacttcgtgcctactcacttcaagatgaaggacttgatacggttgaagct
aatttagctttggggtttgaagaagatgagcgagaatattctattggagcacaaatttta
aaaataattggggtgaaatcattgaaattaatgactaataatccgcaaaagattaatgat
tttcaaaaatatggtctagtagttgaagaaagagtagctctccaaatcaaagataacccc
tttgaccttgattatttaaaagtaaaacaaaataaaatgggacatttgtttgactaa

DBGET integrated database retrieval system