KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1220Help
Entry
CVCAS_1220        CDS       T01964                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00670  One carbon pool by folate
llt01100  Metabolic pathways
llt01120  Microbial metabolism in diverse environments
llt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CVCAS_1220 (metF)
Enzymes [BR:llt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CVCAS_1220 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ADZ63863
Position
complement(1265403..1266254)
Genome map
AA seq 283 aa AA seqDB search
MTSNSKILSFEVFPPTTQIGSTNLVKTLDSLRTLSPDFISVTCSNNNYDNIGDTTIKFAD
YVNNTLDIPAVAHLPAAYLDKAQVIEILERLKDKQIKKILALRGDISDEPMKDDFKFASD
LVKFIKDYDDSFEVLGACYPDIHPESVNRVSDFHYLKEKVDAGCDRLITQLFFDNDSFYD
FQERCAIAEINTPIFAGIMPVINRNQILRLLKNCNTPLPAKFIRILEKYEHNLIALRDAG
IAYAIDQIVDLVTEDVAGIHLYTMNNANTAHSIHASISSLFTF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaattccaaaattctttcttttgaagtttttccacctacaactcaaattgga
agtaccaacttggtaaagaccttggatagcctaagaactctctcgccagattttatcagt
gtaacttgtagtaacaataattatgataatattggagatacaactataaagtttgctgat
tatgtaaacaatacactagatattccagcggttgctcatttacctgccgcttatttagat
aaagctcaagtgatcgaaattttggaacggttaaaagataaacaaatcaaaaaaattctt
gctttaagaggtgatatcagcgatgaaccgatgaaagatgattttaaatttgcaagtgat
ttggttaaatttatcaaagattatgatgatagttttgaagttttaggtgcttgctacccc
gatattcatcccgaatcagtaaatcgagtgagtgattttcattatctgaaagaaaaagta
gatgctggttgtgacagattaatcacgcaactattttttgataatgatagtttctatgat
tttcaagaacgatgcgcaattgctgagataaatactccgatattcgccggaataatgcca
gtaatcaatcgaaatcaaattcttcgtctattaaaaaattgtaatacgccattaccagca
aaattcattagaatactcgaaaaatatgaacataatcttatcgctttaagggatgctgga
attgcttacgccatcgatcaaatcgttgatttagtaacagaggatgttgctggaattcac
ctctatacgatgaataatgcaaatacggcacactccatccatgcttcaatttcttcttta
tttaccttttga

DBGET integrated database retrieval system