KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1227Help
Entry
CVCAS_1227        CDS       T01964                                 

Gene name
dltA
Definition
(GenBank) D-alanine--poly-phosphoribitol-ligase subunit 1
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00473  D-Alanine metabolism
llt01100  Metabolic pathways
llt01503  Cationic antimicrobial peptide (CAMP) resistance
llt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CVCAS_1227 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CVCAS_1227 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CVCAS_1227 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:llt01504]
    CVCAS_1227 (dltA)
Enzymes [BR:llt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     CVCAS_1227 (dltA)
Antimicrobial resistance genes [BR:llt01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    CVCAS_1227 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C CLN3
Motif
Other DBs
NCBI-ProteinID: ADZ63870
Position
complement(1275412..1276911)
Genome map
AA seq 499 aa AA seqDB search
MKLLEQIFEIAKKEPDLIVLAEREQKFTYRQLFAAVSHISEQINERNLNQRPILIFGKND
FITLAAMLATNLRGHAYIPVDAHTPFERTEMIKSAAKPAAVLTTVELSADFEALFTDRIS
LELTDQILTDKLPALDFSKAVSGNDSNYIIYTSGTTGVPKGVEVSHDNLVTFTNWMNNDF
MKIENNQILSQALYSFDLSIFSLYPSLTTGGTLISLSRDETTNFKLLFERLNKTVINTWI
STPSFVDICLLDPSFTEKEHPQLVQFILCGEELTKKTAEKLLTAFPSANIYNTYGPTEAT
GAISSVKITKELLTENDRVPIGFAKPGVDLKIMDKEIIIVGDSVAKGYFENPEKTEQAFF
TVDGKPAYHTGDAGSISADGMLRYQGRIDFQVKFNGFRIELQDIEANIQNLKEIEKAVVL
PKTNDQHKVTALIAYLETEKTFEDRAAERAFTKELKAELSKTIMDYMMPTKFVYLKKFPL
NQNGKVDRKALAQKERGDN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattagaacaaatttttgaaattgcaaaaaaagaaccagaccttattgtactt
gccgagcgtgagcagaaatttacttaccgtcaattatttgccgcggtttcacatatctca
gaacaaatcaatgaacgcaatttaaatcagcgtccaatcttgattttcggtaaaaacgat
tttatcactttagcagccatgcttgcgacaaatttaaggggtcacgcttatattcctgtt
gatgctcacacaccatttgagcggacagaaatgattaaatcagcggcaaaaccagcggcg
gtactcactacagttgagctgtcagcagattttgaagcactttttactgacagaatttct
cttgaacttactgaccagattttgactgacaaacttccagcacttgatttttctaaagct
gtttctggaaatgacagcaattatattatttatacttctggaacaacaggagtaccaaaa
ggtgttgaagtcagtcatgataatcttgtgactttcaccaattggatgaacaatgatttt
atgaaaattgaaaataatcaaatcttgtcacaagccctttacagctttgatttatcaatt
ttcagcttgtatccaagtcttacaactggcggaacattaatttcactctcacgtgacgaa
acaaccaacttcaaattactttttgagcgtttgaacaaaacggtcattaatacttggatt
tcaacaccatcatttgttgatatttgcttattggacccttcgttcactgagaaagaacac
cctcaattagttcaatttattctctgcggtgaagaattaacaaagaaaacagcagaaaaa
ttactaacagcttttccgtcagcaaatatatacaatacctatggtccaacagaagcaaca
ggagccatttcgtcagtaaaaatcacgaaagaattactgacagaaaatgatcgtgtccca
attggttttgccaaaccaggtgttgacttaaaaattatggataaggaaatcatcattgtt
ggtgattcggtagccaaaggttactttgaaaatccagaaaaaactgagcaagcctttttc
acagtcgacggaaaacccgcttatcatacaggagatgccggttcaatttcggctgacgga
atgctccgttaccaaggacgaattgattttcaagttaaatttaatggattccgtattgaa
cttcaagatattgaagccaatattcaaaacttaaaagagattgaaaaagcggtagtctta
ccgaaaacgaatgaccagcataaagtcaccgcattaatcgcttatttagaaacagaaaaa
acatttgaagaccgtgcagccgaacgcgccttcacaaaagaactcaaagctgaactttca
aaaacaattatggattacatgatgccaactaagtttgtttatcttaaaaagttcccattg
aatcaaaatggcaaagttgaccgcaaggcactcgcccaaaaagagcgaggtgacaactag

DBGET integrated database retrieval system