KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1301Help
Entry
CVCAS_1301        CDS       T01964                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00010  Glycolysis / Gluconeogenesis
llt00030  Pentose phosphate pathway
llt00051  Fructose and mannose metabolism
llt00052  Galactose metabolism
llt00680  Methane metabolism
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
llt01120  Microbial metabolism in diverse environments
llt01130  Biosynthesis of antibiotics
llt01200  Carbon metabolism
llt01230  Biosynthesis of amino acids
llt03018  RNA degradation
Module
llt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_1301 (pfk)
   00030 Pentose phosphate pathway
    CVCAS_1301 (pfk)
   00051 Fructose and mannose metabolism
    CVCAS_1301 (pfk)
   00052 Galactose metabolism
    CVCAS_1301 (pfk)
  Energy metabolism
   00680 Methane metabolism
    CVCAS_1301 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CVCAS_1301 (pfk)
Enzymes [BR:llt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CVCAS_1301 (pfk)
Protein phosphatases and associated proteins [BR:llt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CVCAS_1301 (pfk)
Messenger RNA biogenesis [BR:llt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CVCAS_1301 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADZ63941
Position
complement(1355197..1356219)
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccaggaatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagatattttcccgcttacgtcagcttcagttggtgataaa
atcggtcggggtggtacattcttgtattcagcacgctacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgatggttcttatcatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggaacaatcgataacgatatcgtaggaactgattttacaattggatttgat
acagctgtttcaacagttgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacatcaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggtgtaatgactggtgaagaatttgctacaaaacttaaagaagctggttataaa
ggagaccttcgcgtttctgtccttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggtgctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaaca
gctgaagaaggagcactctttagtttgactactgaaggcggaatcaaagtaaataacccg
cataaagctggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system