KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1716Help
Entry
CVCAS_1716        CDS       T01964                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00071  Fatty acid degradation
llt00072  Synthesis and degradation of ketone bodies
llt00280  Valine, leucine and isoleucine degradation
llt00362  Benzoate degradation
llt00380  Tryptophan metabolism
llt00620  Pyruvate metabolism
llt00630  Glyoxylate and dicarboxylate metabolism
llt00640  Propanoate metabolism
llt00650  Butanoate metabolism
llt00900  Terpenoid backbone biosynthesis
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
llt01120  Microbial metabolism in diverse environments
llt01130  Biosynthesis of antibiotics
llt01200  Carbon metabolism
llt01212  Fatty acid metabolism
llt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CVCAS_1716 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    CVCAS_1716 (fadA)
   00640 Propanoate metabolism
    CVCAS_1716 (fadA)
   00650 Butanoate metabolism
    CVCAS_1716 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CVCAS_1716 (fadA)
   00072 Synthesis and degradation of ketone bodies
    CVCAS_1716 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVCAS_1716 (fadA)
   00310 Lysine degradation
    CVCAS_1716 (fadA)
   00380 Tryptophan metabolism
    CVCAS_1716 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CVCAS_1716 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVCAS_1716 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CVCAS_1716 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llt04147]
    CVCAS_1716 (fadA)
Enzymes [BR:llt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CVCAS_1716 (fadA)
Exosome [BR:llt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CVCAS_1716 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADZ64342
Position
1782896..1784044
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNLLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLKAMISSANYIISGEASVICTGGVEST
SQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKAT
QAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIEL
NEAFASQAILFQNYFKLDDIKLNAYGGSLAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNQWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtatcatagcagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacaa
tttaataaaaatctacttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaatcaaggaggaaatttagctcgacgttgtgccttaaaagcaggattttctagccag
gtcccagcttttacaattgaccagcagtgcggttctggactgaaagctatgattagctct
gcaaactacattatttctggtgaagcttccgttatttgtacaggaggggtagaaagcaca
tctcaagccaatattgtgcttgattcagagagttatcagccgattaaccgatttaaaatg
gctcctgaaccctatgaagatttcgacatgggaacaattgccgatatgacagccctaaaa
tacaatattcctcgtagtgttcaagacctttacgctctaaatagtcataaaaaagcgact
caagctattgaaggaaaacttttagaaaatgaagtttttccctatcaagatgaaggattt
acaataagtagcgatcaaactgttcgtcctaaatcctcaatggaagctttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgcccaataaacgat
ggtgcttcttcaatcatattgtcatccactaataatccttttgattttcaaggctattat
ttaggacaaacaactattgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaatttaaccttaaacttaatgatattgaggctatcgaatta
aatgaagcctttgccagtcaggccattttattccaaaattattttaagcttgatgatata
aaattaaatgcttatggtggttcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaaccaagtgcaaaaaccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcaatggtat
caaaaatga

DBGET integrated database retrieval system