KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_2096Help
Entry
CVCAS_2096        CDS       T01964                                 

Gene name
rluA
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Brite
KEGG Orthology (KO) [BR:llt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:llt03009]
    CVCAS_2096 (rluA)
Enzymes [BR:llt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CVCAS_2096 (rluA)
Ribosome biogenesis [BR:llt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CVCAS_2096 (rluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 ChapFlgA
Motif
Other DBs
NCBI-ProteinID: ADZ64716
Position
2139416..2140282
Genome map
AA seq 288 aa AA seqDB search
MEYNFILPENFIEQPVSDLLEKTWFIPRKQRHFLRMKKNCIVNNKLINENQLVHAGDKIT
LIFDNEDFSNLSLKFGSANLADILYEDEHLIVVNKPEGMKAHGNTADELALQNHVAAAIN
QEVFVVHRLDQATSGAVLFAKNQFVLPILGKMFEGNKIHREYLALVKGHFPENQFTIDRA
IGQNRHDKNKRILSAKGQKAVTHVEIIKKFTDKTLVKCTLDTGRTHQIRVHLSSLNHPII
GDALYGQKTQERMMLHADKIIIPHPFENKILEISAISTSFLDILNKTK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaatataacttcattttacccgaaaattttatagaacagcctgtctctgatttactc
gaaaaaacttggttcattcctcgtaaacaaagacactttctaagaatgaaaaaaaattgc
atagtcaataacaagcttattaacgaaaatcagctcgtccatgctggagataaaatcact
cttatttttgataatgaggatttctctaatttatctctaaaattcggttcagcaaattta
gctgacatcctttatgaagacgaacatttgattgttgttaataaacctgaaggaatgaag
gcccacggaaatacggctgatgaattagccttacaaaatcatgttgcagcggcaatcaac
caagaagtttttgttgtccatcgcctggaccaagcaacatctggtgctgttttatttgca
aaaaatcaatttgttctccctattcttggtaaaatgtttgaaggaaataaaattcatcgt
gaatacttggcactagtcaaaggtcatttcccagaaaatcaatttaccattgatcgggcc
attggtcaaaatcgccatgataaaaataaacgaatcctttccgcaaagggtcaaaaagca
gtgactcatgttgagattatcaaaaaatttactgacaaaactcttgttaaatgtacctta
gatactggaagaactcaccaaatacgtgtccatttatcttcattaaatcatcctatcatt
ggtgatgctttgtatggtcaaaaaacacaggagagaatgatgcttcatgctgataaaatt
attattccccatccgtttgaaaataaaattttagaaatttcagcaattagtactagtttc
cttgacattttaaataaaacaaaataa

DBGET integrated database retrieval system