KEGG   Labilithrix luteola: AKJ09_00982Help
Entry
AKJ09_00982       CDS       T04033                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
llu  Labilithrix luteola
Brite
KEGG Orthology (KO) [BR:llu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AKJ09_00982
Enzymes [BR:llu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     AKJ09_00982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 MetW MTS Methyltransf_32 Ubie_methyltran PCMT FtsJ Methyltransf_9 PrmA Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: AKU94318
UniProt: A0A0K1PLB0
Position
complement(979439..980224)
Genome map
AA seq 261 aa AA seqDB search
MPSDAWDPGLYERFKSERRRPFLDTLALVEREPSMRVVDLGCGTGELTRLLHDELGASST
LGIDNSNAMLERAAAFATTQVSFREGDIGAFPATEELASFDLVFSNAALHWAPNHERVLE
HWTSALTPRGQLAVQLPATGDRIWESIAEEVGREAPFADVLGNVGPLGGRAHTPKWYAQT
LAQLGYRNQHVRLQVYGHWLPGPEGVVTWAEGALLTKYRALLGADLYATFLARYRERLLE
QLEDVRPFFFPFERILFWARK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgacgcatgggacccgggcctctacgagcgcttcaagagcgagcgaaggcgt
ccgttcctcgacacgctcgcgctggtcgagcgagagccgtcgatgcgcgtcgtcgatctc
ggttgcggaacgggagagctcacgcgattgctccatgacgagctcggggcgtcgtcgacg
ctcggtatcgacaactccaatgccatgctcgagcgagcggcggcgtttgcgacgacccag
gtgagctttcgcgaaggtgacatcggggcctttcccgcgaccgaggagctcgcgtcgttc
gatctggtcttctcgaatgctgcgctccactgggcaccgaaccacgaacgcgtgctcgaa
cactggacaagcgcgctcacgccgcgaggtcagctcgccgtccagctaccggccacgggc
gatcgcatctgggagagcatcgccgaggaggtcggccgcgaggcgccgttcgccgacgtc
ctcgggaacgtgggcccgctcggcggtcgcgcgcacacgcccaagtggtacgcgcagacg
ctcgcgcaactcgggtatcgcaaccaacacgtgaggctccaggtctacgggcactggctg
cccggtcccgagggcgtcgtgacgtgggcggagggggcgctgctcaccaagtaccgagcg
ctgctcggggcggacctctacgcgacgtttctcgcgcgctaccgcgagcgactcttggaa
cagctcgaggacgtgcggccgttcttcttcccgttcgagcgcatcctgttttgggcgcga
aaatag

DBGET integrated database retrieval system