KEGG   Labilithrix luteola: AKJ09_01101Help
Entry
AKJ09_01101       CDS       T04033                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
llu  Labilithrix luteola
Pathway
llu00450  Selenocompound metabolism
llu00970  Aminoacyl-tRNA biosynthesis
llu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AKJ09_01101
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AKJ09_01101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llu01007]
    AKJ09_01101
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:llu03016]
    AKJ09_01101
Enzymes [BR:llu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AKJ09_01101
Amino acid related enzymes [BR:llu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AKJ09_01101
Transfer RNA biogenesis [BR:llu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AKJ09_01101
 Prokaryotic type
   Other AARSs
    AKJ09_01101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AKU94437
UniProt: A0A0K1PLP0
Position
1099241..1101265
Genome map
AA seq 674 aa AA seqDB search
MGRFYVTTPIYYVNDVPHLGTAYTTIVADALRRFHQLTGDETFMLTGTDEHGLKIERQAK
EAGLDPKAFTDKISERFREAWPKLEVVADRFIRTTDPDHEAWVAELWKTIEAKGDLYLDT
YEDWYCVGCESFKTEKELEQPGNLCPIHKKPVERVKEETYFFKLSKWEKPLLDFYARHPD
FIQPESRKNEVISFVQSGLKDLSVSRTSFSWGIPVPGNPKHVMYVWFDALANYRSALGDG
DKANFWAPNAKVVHLVGKDILRFHAIFWPAFLLSAGYKEEEIPDVVFAHGFLTIDGHKMS
KSLRNAVDPLKIAAELGPDVLRYHLLRAIAFGQDGDFDHAALIERYNADLGKNLGNLLSR
VLGLCTKLMEGKVPTLGKFTPLEDEFFALAKNELATARQAWLDLEPHRALEATFALSSAA
NTYVDRAAPWASVKTDPAHTGTQLAVLLEALAALSAAIWPAMPKKSDAMRAQLGLPPIAP
AEGKDVFPSELGGALQAGKPLAPSGALFQTFDKDGTKAVLERLVPKVEEAAAEAAAPANK
AEKPGAAPAAQAGEAESATITYEDFAKVDLRVGLVKTCEKVPKKDKLLRLTVDLGEETPR
TIVAGLALSFQPDQLVGRKVIVVSNLAPRDFGSADFGKGKEKLVSHGMLLASGPSEDLRL
ATVEGDAAPGVRLK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgggacgcttctacgtcacgactccgatctactacgtgaacgacgtgcctcatctcggc
accgcgtacaccacgatcgtcgcggacgcgctccgccgcttccaccagctcacgggcgac
gagaccttcatgctcaccggcacggacgagcacggcctcaagatcgaacgtcaggcgaag
gaagcaggactcgaccccaaggccttcaccgacaagatcagcgagcggttccgcgaggcg
tggccgaagctcgaggtcgtcgccgaccgcttcatccgcacgaccgatcccgatcacgag
gcgtgggtcgccgagctctggaagacgatcgaagcgaagggcgacctttacctcgacacc
tacgaggactggtactgcgtcggttgcgagtccttcaagacggagaaggaactcgagcaa
cccggcaacctctgcccgatccacaagaagcccgtcgagcgcgtgaaggaggagacgtac
ttcttcaagctctcgaagtgggaaaagcccctgctcgatttctacgcgcgccatcccgac
ttcatccagcccgagtcgcgcaagaacgaggtcatctcgttcgtgcagagcggactcaag
gatctgtcggtttcgcgcacgagcttctcgtggggcatccccgtcccgggcaacccgaag
cacgtcatgtacgtctggttcgacgcgctcgcgaactaccgcagcgccctcggcgacggc
gacaaggcgaatttctgggcgccgaacgcgaaggtcgtccacctcgtcggcaaagacatc
ctccgcttccacgccatcttctggcccgcgttcctgctcagtgcaggatacaaggaagag
gagatccccgacgtcgtcttcgcgcacggcttcttgaccatcgacggtcacaagatgtcg
aagtcgctccgcaacgcggtcgacccgctcaagatcgccgccgagctcgggcccgacgtt
cttcgctatcacctgctccgcgccattgcgttcgggcaagacggcgacttcgatcacgcc
gcgctcatcgagcgttacaacgccgacctcggcaagaacctcggcaacctgctgtcgcgc
gtcctcggtctctgcaccaagctcatggagggcaaggtgccgacgctcgggaagttcacg
cccctcgaagacgagttcttcgcgctcgcgaagaacgagctcgcgacggcgcgccaggca
tggctcgatctcgagccgcatcgcgcgctcgaggcgacgttcgccctcagctcggcagcc
aacacgtacgtcgatcgcgcggctccttgggccagcgtgaagacggatccggcgcacacc
ggcacgcagctcgccgttctcctcgaggcgctcgcggcactgtcggccgcgatctggccg
gcgatgccgaagaagagcgacgcgatgcgcgcgcagctcggtctgccgccgatcgccccg
gccgaaggcaaagacgtcttcccgagcgagctcggaggagccctccaggccggcaagccg
ctcgcgccctcgggtgcgctcttccagacgttcgacaaggacggaacgaaggcagttctc
gagcgcctcgtcccgaaggtcgaagaggccgccgccgaagccgccgcaccggcgaacaag
gccgagaagcccggcgcggcacctgcggcgcaggcgggcgaggccgagagcgcgaccatc
acgtacgaggacttcgcgaaggtcgacctccgtgtcggactcgtgaagacatgtgagaag
gtcccgaagaaggacaagcttctccggctcaccgtcgatctcggagaagagacgccgcgc
accatcgtggcggggctcgctctctccttccaacccgaccagctcgtcggacggaaggtg
atcgtggtcagcaacctcgctccccgcgacttcggctcggccgacttcggcaagggcaag
gagaagctggtgtcgcacggtatgctcctggcaagcggtccgtccgaagaccttcgcctg
gccaccgtcgaaggcgacgctgcaccgggagtgcggctgaagtaa

DBGET integrated database retrieval system