KEGG   Labilithrix luteola: AKJ09_03596Help
Entry
AKJ09_03596       CDS       T04033                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llu  Labilithrix luteola
Pathway
llu00071  Fatty acid degradation
llu00072  Synthesis and degradation of ketone bodies
llu00280  Valine, leucine and isoleucine degradation
llu00310  Lysine degradation
llu00362  Benzoate degradation
llu00380  Tryptophan metabolism
llu00620  Pyruvate metabolism
llu00630  Glyoxylate and dicarboxylate metabolism
llu00640  Propanoate metabolism
llu00650  Butanoate metabolism
llu00900  Terpenoid backbone biosynthesis
llu01100  Metabolic pathways
llu01110  Biosynthesis of secondary metabolites
llu01120  Microbial metabolism in diverse environments
llu01130  Biosynthesis of antibiotics
llu01200  Carbon metabolism
llu01212  Fatty acid metabolism
llu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKJ09_03596
   00630 Glyoxylate and dicarboxylate metabolism
    AKJ09_03596
   00640 Propanoate metabolism
    AKJ09_03596
   00650 Butanoate metabolism
    AKJ09_03596
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKJ09_03596
   00072 Synthesis and degradation of ketone bodies
    AKJ09_03596
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKJ09_03596
   00310 Lysine degradation
    AKJ09_03596
   00380 Tryptophan metabolism
    AKJ09_03596
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AKJ09_03596
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AKJ09_03596
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AKJ09_03596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llu04147]
    AKJ09_03596
Enzymes [BR:llu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AKJ09_03596
Exosome [BR:llu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKJ09_03596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Ketoacyl-synt_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKU96932
UniProt: A0A0K1PTT7
Position
complement(3681599..3682783)
Genome map
AA seq 394 aa AA seqDB search
MSLAPVYIVSATRTPIGAYLGSLSSLTAPQLGAAVIKAALERAKVSPDQVGEVFMGNVLS
AGIGQAPARQAMRFAGLPDNVPATTVSKVCGSGMQALIFGAKTIALGDSDIVVAGGMESM
SNVPYYAMQARQGYRMGNAPFVDGMIHDGLWDPYANVHMGTCGDKTAAEYKVSREAQDEF
AKESFRKALSAQKEGQFDAEITPVAVPQRKGDPVMVKLDEGPAKGDPAKIGGLKPAFSKD
GTITAANASSINDGASALVLASEAAVKKHGLSPLARIVGYGSAAQAPEWFTTAPAKAMDS
TLAKVGLTPNDIDLVEINEAFAVVAMVSAQLSKLDPAKVNVRGGAVALGHPIGASGARIV
TTMLHALKDMNKKRGLASICIGGGEALAMVLERA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgcccccgtgtacatcgtctcggccacccggacccccatcggcgcgtacctc
ggctcgttgtcctcgctgacggcaccgcagttgggcgcggccgtgatcaaggccgcgctc
gagcgcgcgaaggtctcccccgaccaggtcggtgaagtcttcatgggcaacgtgctctcg
gccggcatcggtcaggcgcccgcccgccaggcgatgcgcttcgccggcctccccgacaat
gtccccgccaccacggtgagcaaggtctgcggctcgggcatgcaggcgctcatcttcggc
gcaaagaccatcgccctcggcgactcggacatcgtcgttgccggcggtatggagtcgatg
tcgaacgtgccctactacgcgatgcaggcccgccagggttaccgcatgggcaacgccccc
ttcgtcgacggcatgatccacgacggcctttgggatccgtacgcgaacgtccacatgggc
acctgcggtgacaagaccgcggccgagtacaaggtctcgcgcgaggcgcaggacgagttc
gcgaaggagagcttccgcaaggccctctcggcccagaaggaaggccagttcgacgcggag
atcacccccgttgccgttccgcagcgcaagggcgaccccgtcatggtgaagctcgacgag
ggtccggccaagggcgaccccgcgaagatcggcggcctcaagcccgccttcagcaaggac
ggcacgatcaccgcggcgaacgcctcgtcgatcaacgacggcgcgagcgctctcgttctc
gccagcgaagcggccgtgaagaagcacggtctctcgcccctcgcgcgcatcgtcggctac
ggcagcgcggcgcaggcgcccgagtggttcaccacggcccccgcgaaggccatggactcg
acgctcgcgaaggtcggtctgacgccgaacgacatcgacctcgtcgagatcaacgaagcc
ttcgccgtcgtcgcgatggtgtcggcgcagctctcgaagctcgaccccgcgaaggtcaac
gtccgcggcggcgcggtggccctcggtcacccgatcggcgcgagcggcgcgcgcatcgtc
accacgatgctccacgccctgaaggacatgaacaagaagcgcggcctcgccagcatctgc
atcggcggcggcgaagcgctcgccatggtgctcgagcgcgcctga

DBGET integrated database retrieval system