KEGG   Labilithrix luteola: AKJ09_04693Help
Entry
AKJ09_04693       CDS       T04033                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
llu  Labilithrix luteola
Pathway
llu00471  D-Glutamine and D-glutamate metabolism
llu00550  Peptidoglycan biosynthesis
llu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AKJ09_04693
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AKJ09_04693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:llu01011]
    AKJ09_04693
Enzymes [BR:llu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     AKJ09_04693
Peptidoglycan biosynthesis and degradation proteins [BR:llu01011]
 Precursor biosynthesis
  Amino acid ligase
   AKJ09_04693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C AlaDh_PNT_C TrkA_N 2-Hacid_dh_C NAD_binding_7 UDPG_MGDP_dh_N DUF99 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKU98029
UniProt: A0A0K1PY04
Position
4819565..4820935
Genome map
AA seq 456 aa AA seqDB search
METFDLKDKRVVVVGLGLSGVAACRLLASRGAHVVGTDSKKTVSDDVRALEKEGVRLVLG
GHAEAGLETADLVVVSPGVPSFPELVAAEMAKVPIWGEVELAVRAVNASAAAAGRALPRV
VAVGGTNGKSTTTSLVGALLEAHGLKTFLGGNLGEPLASHADEAWDVVVLEVSSFQMERV
DAFHPQVSILLNVTPDHLDRYPSMEAYAAAKGNAFVLQRSTDVAVVPVRDDVCIAQAKRG
RGTIVQFGPGGDLDVTDEAVIDRASGVAYERSKMRLQGGHNALNVAAAIGAVRPFGLTPD
TIRSVLASFEGLAHRMALVAEVKGVRYYDDSKGTNVGASVTAVRGVVEPKVVLIAGGRDK
GGSYGPLVSALRDKGRAAVVIGEAADVIASAIGDAVPVRRASSMDDAVVLSSELAREGDA
VLLSPACSSFDMFRDYKHRGDAFVDAVKNLSSRGVA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccttcgacctgaaagacaagcgcgtcgtcgtggtgggcctcgggctctccggc
gtggccgcttgccgtctgctcgcgtcgcgcggggcacacgtcgtcggcaccgacagcaag
aagaccgtctcggacgacgttcgcgcgctcgaaaaagagggcgtgcgcctcgtgctcggt
ggtcacgccgaggcaggcctcgagacggccgatctcgtcgtcgtctctcccggcgttccg
agctttcccgagctcgtggccgcagagatggcgaaggttccgatctggggcgaggtcgag
ctcgcggttcgcgcggtcaatgcttcggcggcagctgccggtcgtgcgcttccgcgcgtc
gtggccgtcggcggcacgaacggcaagagcacgacgacttcgctggtcggtgcgctcctc
gaagcccatggcctgaagacgttcctcgggggcaacctcggtgagccgcttgcttcccat
gccgacgaggcgtgggacgtcgtggtgctcgaggtgtcgagcttccagatggagcgcgtc
gatgcgttccatccgcaggtctccattctcctcaacgtcacacccgaccacctcgatcgc
taccccagcatggaggcctacgccgccgccaagggcaacgcgttcgtgcttcagcgctcg
accgacgtggccgtcgtccccgtgcgtgacgacgtgtgtattgcgcaggcaaaacgcggt
cgcggcacgatcgtccagttcggcccgggcggcgacctcgacgtgaccgacgaggccgtg
atcgaccgcgcctcgggcgttgcttacgagcgcagcaaaatgcgcctccagggcggccac
aacgcgctcaacgtcgcggccgccatcggcgccgttcgtccgttcggcctcacgcccgac
acgatccgcagcgtgctcgccagcttcgaaggactcgcccaccgcatggcgctcgtcgcc
gaggtgaagggcgttcgctactacgacgactcgaagggcacgaacgtcggcgcgtcggtc
accgcggtgcggggcgtggtcgagccgaaggtcgttctcatcgcgggcggtcgtgacaag
ggcggaagctacgggccgctcgtctccgcgcttcgcgacaagggccgcgcggccgtcgtc
atcggcgaagcggccgacgtgattgcgagcgccattggcgacgcggttcccgttcgtcgc
gccagctcgatggacgacgccgtcgttctctcctcggagcttgcacgtgaaggcgacgcc
gttttgctttcgccggcctgctcgagcttcgacatgttccgggactacaagcaccggggc
gacgcgttcgtggatgccgtgaagaacctctccagccgcggggtggcgtga

DBGET integrated database retrieval system