KEGG   Labilithrix luteola: AKJ09_05551Help
Entry
AKJ09_05551       CDS       T04033                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
llu  Labilithrix luteola
Brite
KEGG Orthology (KO) [BR:llu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:llu03016]
    AKJ09_05551
Enzymes [BR:llu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AKJ09_05551
Transfer RNA biogenesis [BR:llu03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    AKJ09_05551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AKU98887
UniProt: A0A0K1PZG6
Position
complement(5760204..5760896)
Genome map
AA seq 230 aa AA seqDB search
MTDVPSALPPIELLHVDEHVVVANKPSGLLVHRGWDDDDDVAMFRVRDMLGGQHVHPLHR
LDRGTSGALAFARTKEAASTMARAFEDGAVGKRYLALVRGMAPERGVIDYAIQKAEDGPR
VPAVTDFELVAHSSVDRCSLVCAMPRTGRLHQIRRHLRHINHPLVGDVKHGSGAINRHYR
AQYNLHRLALHAFELAFDHPMTKERVVVRAPMPDDLGLALDALGLPREVS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgccctcggcgctgccgcccatcgagcttctccacgtcgacgaacacgtg
gtggtggccaacaagccttcgggtctgctcgtgcatcgcggttgggacgacgacgacgac
gttgccatgttccgcgtgcgcgacatgctcggcggccagcacgtgcatccgctccatcga
ctggaccggggaacgagcggcgcactggccttcgcgcgcacgaaggaagccgcttcgacc
atggcgcgggcgttcgaagacggcgccgtcggcaagcgctacctcgcgctcgtgcgcggc
atggcgccggaacggggcgtcatcgactacgccatccagaaggcagaagacggcccgcgc
gtgccggccgtgaccgacttcgagctcgtggcccactcctccgtggatcgctgttcgctc
gtgtgcgccatgccccgcacgggaaggctccatcaaatccgacgtcacctgcggcacatc
aatcatccgctcgtcggcgacgtgaagcacggctcgggcgccatcaaccgccactaccgt
gcacaatacaaccttcatcgattggcactccacgccttcgagctcgccttcgatcatccg
atgaccaaggagcgcgtcgtggtccgcgctccgatgcccgacgatctggggcttgccctc
gacgcgctcggcctgccccgcgaggtttcatga

DBGET integrated database retrieval system