KEGG   Labilithrix luteola: AKJ09_05894Help
Entry
AKJ09_05894       CDS       T04033                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
llu  Labilithrix luteola
Pathway
llu00520  Amino sugar and nucleotide sugar metabolism
llu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AKJ09_05894
Enzymes [BR:llu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     AKJ09_05894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short ATPgrasp_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: AKU99230
UniProt: A0A0K1Q0D4
Position
6157605..6158579
Genome map
AA seq 324 aa AA seqDB search
MRRFLILGGAGLVGSHLCDRLLAAGREVIVVDDLSSGSYANVAHWKFEPRFAFVEHDVRS
AFDAKVDVIFHLALPSSRASCRRDPVGAAMTCIDGTRLALDAAARAGARLVIVTSTERWG
HGARSAESFALDFAKQRGLDVRIVRHASVYGARMAPDGDHVVSTLALRALRGETLEGGRH
DATDTYRVVHVDEVVETLVRTIVASHRPPPLLAGYAETSFETIARIVTAAAHTTLGVTGT
TMRGSVATVQGNTAPHGSVASFSNTPSLEGALPAAHVLGPLPSVELADGVARTVTWFAAR
IAHFFDRESRGAFARTDAARETVS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgctttctgatcctcggtggtgcgggccttgtcggctcccacctctgtgatcgg
cttctcgccgcggggcgggaggtcatcgtcgtcgacgacctctcgagcggcagctacgcg
aacgtcgcgcattggaagttcgagccgcgcttcgccttcgtggagcacgacgttcgctcg
gccttcgacgcgaaggtggacgtcatcttccacctcgcgcttccgtcgtctcgcgcgagc
tgccgccgagaccccgtcggtgccgcgatgacctgcatcgacgggacgaggctcgctctc
gacgccgcagcccgtgcgggggcgcggctcgtcatcgtgacctcgaccgaacgctggggg
catggagctcgttcggccgagtcgttcgccctggacttcgcgaagcagcgtgggctcgac
gttcgtatcgtgcggcacgcttcagtctacggcgctcggatggcgccggacggagaccac
gtcgtcagcacgctcgcgctccgagcgttgcgtggcgagaccctcgaaggcggtcgacac
gacgccacggacacgtaccgcgtcgttcatgtcgacgaggtcgtcgagacgctggtgcgg
acgatcgtcgctagccatcggccaccgcctcttctggcggggtacgcagagacgagcttc
gaaacgatcgctcgcatcgtgacggcagcggcgcataccaccttgggcgtgacgggaacg
acaatgcggggcagcgtcgccacggtgcaggggaacactgcgccgcacgggtcggtcgcg
tcgttctcgaataccccaagcttggagggagcgttgcctgcggcacacgtcctcggtccg
ctgccatcggtcgagctcgcagacggcgtcgcgcgcacggtgacatggtttgcagcgcgg
atcgcccacttcttcgaccgtgaatcgcgaggcgcgtttgcgcggacggatgccgcgcgg
gaaacggtctcataa

DBGET integrated database retrieval system