KEGG   Labilithrix luteola: AKJ09_09736Help
Entry
AKJ09_09736       CDS       T04033                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
llu  Labilithrix luteola
Brite
KEGG Orthology (KO) [BR:llu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:llu03009]
    AKJ09_09736
Enzymes [BR:llu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AKJ09_09736
Ribosome biogenesis [BR:llu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AKJ09_09736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AKV03073
UniProt: A0A0K1QBG1
Position
10287846..10288913
Genome map
AA seq 355 aa AA seqDB search
MTRLRVSESDFVRPEGVPEGSIVSVFRVPPELAGQRLDVFLQGQLKRTSRTRTQFIVKNS
AFDVRGKRLRSNHRVQEEEHVLLWRPPWDEEPVPTEVPILHEDEHLFAVNKPSLLPVHPT
ARYHKNTLINVLKRERPGVFLSLGHRIDRETSGVLLVSKSPDCDRTLKKRLEERAGITKT
YTAITWGVPDPALGPQVGGAVSPADDAPNAFRFERSLELDPVSPYKVKMRLGITDDAMSA
STRFIVEDTRSRKDGRTYARVRCELETGRQHQIRIHLASLGAPIVGDKLYGPDDTCFPRG
ADGLLTDEDFEKLELPRHALHASRMTLAHPMTGEHLAIEAPLPADLQAFWNSLAE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggctccgtgtgtccgaaagcgacttcgtccgccccgaaggggtgccggagggt
tcgatcgtgagcgtctttcgggtccccccggagctcgccgggcagcgcttggacgtgttt
ctccagggccagctcaagcgcacgagccggacgcgcacgcagttcatcgtgaaaaacagc
gcgttcgacgtccgcggcaagcggctgcgctcgaatcaccgcgtccaggaggaggagcac
gttctgctctggcgccccccgtgggacgaggagcccgtccccaccgaggtgcccatcctc
cacgaagacgagcacctgttcgccgtcaacaagccttccctgctcccggtccaccccacc
gcgcgctaccacaagaacacgctcatcaacgtgctcaagcgcgagcgtcccggcgtgttc
ctctcgctcggtcaccgcatcgatcgcgagacgagcggcgtgctcttggtatcgaagtcg
cccgattgcgaccgcacgctcaaaaagcgtctcgaggagcgcgcaggcatcacgaaaacg
tacaccgcgatcacctggggcgtgcccgatcccgcgctcggcccgcaggtcggcggagcg
gtctcgccggccgacgacgcgcccaacgcgttccgtttcgagcgatccctcgagctcgat
ccggtgagcccttacaaagtgaagatgcgtctcggcatcaccgacgacgcgatgtcggcc
tcgacgcgcttcatcgtcgaagacacacgatcacgaaaagacgggcgcacgtatgcccgc
gtgcgctgcgagctcgagaccggacggcagcatcagatccgcatccacctcgcgtcgctc
ggcgcccccatcgtgggcgacaagctctatggcccggacgacacgtgctttccgcgcggc
gccgacggcctgctcacggacgaagacttcgagaaactcgagctaccgcgccacgcgctc
cacgcgtcgcgcatgacgctcgctcacccgatgacgggcgagcacctcgccatcgaagcg
ccgctcccggccgatcttcaggcgttctggaattcgctcgccgagtga

DBGET integrated database retrieval system