KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_0929Help
Entry
kw2_0929          CDS       T02848                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
llw00670  One carbon pool by folate
llw01100  Metabolic pathways
llw01120  Microbial metabolism in diverse environments
llw01200  Carbon metabolism
Module
llw_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:llw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    kw2_0929
Enzymes [BR:llw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     kw2_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AGV72887
UniProt: T2F5X6
Position
950617..952284
Genome map
AA seq 555 aa AA seqDB search
MKTDIEIAQAAEIQPITKIAEKIGLSFDDIELYGKYKAKIPLEVLEKFDEQTDGKLVLVT
SINPTPAGEGKSTVTVGLADAFARQDKNVMVALREPSLGPVMGIKGGAAGGGFAQVLPME
DINLHFTGDIHAITTANNAISAFLDNSLHQGNPLNIDPRRIIWKRVLDLNDRALRHVTIG
LGGPLNGVPREDGFDITVASEIMAVLCLATSISDLKERLARIVIAQNYDRKPVSVGDLGV
QGAIAMLLKDALKPNLVQTIEGTPALIHGGPFANIAHGCNSVLATKTALKLADIVITEAG
FGADLGGEKFLDIKTRQLGKQPDAVVIVATLRALKMHGGVDKKELTSENVEAVKKGFANL
ERHIKNMQSYGLPVIVAINQFASDTESEISTLKELTEALGVSVSLTQVFAKGGEGGLDLA
EKLSVMLQEKSDFRYLYELNQPLSVKLDKVVTEIYGGSKVNLSPKAKRQMREIEENGWNN
LPVCMAKTQYSFSDQANLLAAPEGFEVTVRELIPKIGAGFIVALLGDVMTMPGLPKNPAA
LKMDVTDDGKISGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaattgcccaagctgctgaaattcaaccaattactaaaattgcc
gaaaaaataggattatcttttgatgatattgaactttacgggaaatataaggctaaaatt
cccttagaagtgttagaaaagtttgatgaacaaaccgatgggaaattggttttagtgaca
tctattaaccctacaccagcgggtgagggtaaatcgacggtgacagtgggccttgctgat
gcctttgccagacaagataaaaatgtaatggttgctctacgggagccttctcttggtccg
gtcatgggaattaaaggtggagcagctggtggtggatttgctcaagttcttccaatggaa
gacattaatcttcattttacaggagatattcatgccattacaacggctaataatgcaatt
tcggcttttctggacaattcgcttcatcaagggaatcctttaaatattgacccacgaaga
attatctggaaacgtgtgcttgatttgaacgaccgtgctttacgtcatgtaacgattgga
ctgggtggaccgcttaatggggttcctcgtgaggatggttttgatattacggtggctagc
gaaattatggctgttctttgtttggcgacttctatcagtgatttgaaagagcgcttagca
agaattgtcatcgctcaaaattatgaccgtaaacctgtcagtgtcggagatttaggggtt
cagggggcaattgcaatgctcttaaaagatgcccttaaaccaaaccttgttcaaacaatt
gaaggaacgccagctttaattcacggtggaccttttgctaatattgcccatggatgtaat
tctgttttagcaacaaaaacagcacttaaattggctgatattgtcattacagaggcagga
tttggagctgaccttggtggtgaaaaatttttggatatcaagacacgtcagttagggaaa
caacctgatgctgtggtaattgtggctacacttcgtgcgcttaagatgcacggtggcgtt
gataagaaagaattgacaagtgaaaatgtcgaggctgttaaaaaaggttttgctaatttg
gaacggcatatcaaaaacatgcaaagttatggcctgccagtgattgtagcgattaatcaa
tttgcatcggatacagagtcagaaatttcaactttaaaagaactgacagaagctttggga
gtttcagtttcactaactcaagtttttgctaaaggtggtgaaggcggtttagatttggct
gaaaaactgtcagtaatgttacaagaaaaatctgatttccgctatctttatgagctaaat
caacccttgtcagtaaaacttgacaaagttgtgacagaaatttatggcggttccaaagtt
aatttatctccgaaagctaagcgtcagatgagagaaattgaagaaaatggttggaataac
ttgccggtttgtatggctaaaacgcagtattcattttcagaccaagcgaatcttttagca
gctcccgaaggctttgaggttacagtgcgtgagctgattccgaaaatcggtgctggattt
attgttgctcttttaggagatgtgatgacgatgccaggtctgcccaaaaatcctgctgct
ttaaaaatggacgtgactgatgatggtaaaatctcaggattattttag

DBGET integrated database retrieval system