KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_1527Help
Entry
kw2_1527          CDS       T02848                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
llw00071  Fatty acid degradation
llw00072  Synthesis and degradation of ketone bodies
llw00280  Valine, leucine and isoleucine degradation
llw00362  Benzoate degradation
llw00380  Tryptophan metabolism
llw00620  Pyruvate metabolism
llw00630  Glyoxylate and dicarboxylate metabolism
llw00640  Propanoate metabolism
llw00650  Butanoate metabolism
llw00900  Terpenoid backbone biosynthesis
llw01100  Metabolic pathways
llw01110  Biosynthesis of secondary metabolites
llw01120  Microbial metabolism in diverse environments
llw01130  Biosynthesis of antibiotics
llw01200  Carbon metabolism
llw01212  Fatty acid metabolism
llw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    kw2_1527
   00630 Glyoxylate and dicarboxylate metabolism
    kw2_1527
   00640 Propanoate metabolism
    kw2_1527
   00650 Butanoate metabolism
    kw2_1527
  09103 Lipid metabolism
   00071 Fatty acid degradation
    kw2_1527
   00072 Synthesis and degradation of ketone bodies
    kw2_1527
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    kw2_1527
   00310 Lysine degradation
    kw2_1527
   00380 Tryptophan metabolism
    kw2_1527
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    kw2_1527
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    kw2_1527
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    kw2_1527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llw04147]
    kw2_1527
Enzymes [BR:llw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     kw2_1527
Exosome [BR:llw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   kw2_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGV73485
UniProt: T2F5X0
Position
complement(1610786..1611925)
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIFGNVLQAG
NGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQNSQEKAV
AASQAGIFNDEIVALGKLSVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
LILATKDYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLSEIDLFEI
NEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKREQKRYGIA
SLCIGGGLGLAILLKNPDF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagtcggaaaatatgatggtgct
cttgctgagtattcggcagaaaagctcggaacacacgttgtttcagctttattgtcaaaa
aataaaaatataaaatcagatgttgaacaagttatttttggtaatgttcttcaagctggt
aatggtcaaaatattgcgcgccaaattgcgattaatagtggtttatcaaccagtgttcca
gcttcaaccattaatgaagtttgtggttcagggatgaaggcagtaattctagctaagcaa
cttttacagttgggcgaagcagaagttgttattgctggtggaacggaatcaatgtctaat
gcgcctattcttaaaaatcgtaaaactgaagaagaaacattaagcatgttaagtgacggg
ttaattgatgctttttctggcatttcaatgggaattattggagaaacaattgcggagcag
tttgatgttagtcgtgctgaccaagacctattcgcacaaaattctcaagagaaggcagta
gcagccagtcaagcaggaatttttaatgacgagattgtagctcttgggaaactttctgtt
gatgaaactcctcgaccttcatctagcttggaaaaattggctacattacggacagccttt
aaggaaaatggaacagttacagctgggaattcttcaccagttaatgacggagcctctgct
ttaattttggctactaaagattacgctgaaaaacatggaatttcttatttagctgaatta
gttgagagtgcggaagttggtattgaccctgcaattatgggagtatcaccgattgatgca
attcaaaaattagttcaacgctcaggcgttcagctttcagaaatagatctttttgaaatt
aatgaggcctttgctgcatcaagtattgctgttaatcgtgaattgggcttaaaagattct
caagttaatatttacggaggagcgattgctcttggacatgctattgggtcaagtggtgcc
aaaatcctgacaactttgggatatgctttgaaacgagaacaaaagcgttatggaattgct
agtctttgtattggcggtggtctagggcttgctattttattgaaaaatcctgacttttaa

DBGET integrated database retrieval system