KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_1890Help
Entry
NCDO2118_1890     CDS       T03437                                 

Gene name
fadA
Definition
(GenBank) Acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00071  Fatty acid degradation
llx00072  Synthesis and degradation of ketone bodies
llx00280  Valine, leucine and isoleucine degradation
llx00362  Benzoate degradation
llx00380  Tryptophan metabolism
llx00620  Pyruvate metabolism
llx00630  Glyoxylate and dicarboxylate metabolism
llx00640  Propanoate metabolism
llx00650  Butanoate metabolism
llx00900  Terpenoid backbone biosynthesis
llx01100  Metabolic pathways
llx01110  Biosynthesis of secondary metabolites
llx01120  Microbial metabolism in diverse environments
llx01130  Biosynthesis of antibiotics
llx01200  Carbon metabolism
llx01212  Fatty acid metabolism
llx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCDO2118_1890 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    NCDO2118_1890 (fadA)
   00640 Propanoate metabolism
    NCDO2118_1890 (fadA)
   00650 Butanoate metabolism
    NCDO2118_1890 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCDO2118_1890 (fadA)
   00072 Synthesis and degradation of ketone bodies
    NCDO2118_1890 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCDO2118_1890 (fadA)
   00310 Lysine degradation
    NCDO2118_1890 (fadA)
   00380 Tryptophan metabolism
    NCDO2118_1890 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCDO2118_1890 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCDO2118_1890 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCDO2118_1890 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llx04147]
    NCDO2118_1890 (fadA)
Enzymes [BR:llx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCDO2118_1890 (fadA)
Exosome [BR:llx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCDO2118_1890 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AII13345
Position
2027462..2028610
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNPLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASIICTGGVEST
SQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKAT
QAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTVALSPSDFLLGPIKATEKLLQKFSLKLNDIEAIEL
NEAFASQAILFQNYFKLDGTKLNAYGGALAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNHWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtatcatagcagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacag
tttaataaaaatccacttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaatcaaggaggaaatttagctcgacgttgtgccttaaaagcaggattttctagccag
gtcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaactacattatttctggcgaagcttccattatttgtacaggaggggtagaaagcaca
tctcaagccaatattgtgcttgattcagagagttatcagccgattaaccgatttaaaatg
gctcctgaaccctatgaagatttcgacatgggaacaattgccgatatgacagccctaaaa
tacaatattcctcgtagtgttcaagacctttacgctctaaatagtcataaaaaagcgact
caagctattgaaggaaaacttttagaaaatgaagtttttccctatcaagatgaaggattt
acaataagtagcgatcaaactgttcgccctaaatcctcaatggaagccttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgcccaataaacgat
ggtgcttcttcaatcatattgtcatccactaataatccttttgattttcagggctattat
ttaggacaaacaactgttgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaatttagccttaaacttaatgatattgaggctatcgaatta
aatgaagcatttgccagtcaggccattttattccaaaattattttaagcttgatggtaca
aaattaaatgcttatggtggtgcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaaccaagtgcaaaagccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcactggtat
caaaaatga

DBGET integrated database retrieval system