KEGG   Leishmania major: LMJF_01_0220Help
Entry
LMJF_01_0220      CDS       T01014                                 

Gene name
CYP12
Definition
(RefSeq) putative cyclophilin 12
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
lma  Leishmania major
Brite
KEGG Orthology (KO) [BR:lma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LMJF_01_0220 (CYP12)
Enzymes [BR:lma01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     LMJF_01_0220 (CYP12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 12983115
NCBI-ProteinID: XP_003721542
GeneDB: LmjF.01.0220
UniProt: E9AC11
Position
1:complement(57026..58033)
Genome map
AA seq 335 aa AA seqDB search
MKGVTSFTVYGLVPAADFQRCAEAAAYVNDKYPESYAVIVKLELPRDFAERRAAWASAGH
LPSQQQQPTDASFGESGGSATTASTAAAELAAVLVEQHGSDSEPQCLLTAETFLHNIATH
TDYKPDATEDYYTARGKRAWRAFLASRGRQYCWMDVSVDGVAVGRVWFELYASVAPLTCK
NFCELCRGTTVAMGDTVAHSSVFDPPPAQHIGYKGTTFFRTLKDAWVMGGDVTGAHSGNG
GYSCYGRCFPDETYAVPHDAAGILGMCNDGPHTSSSAFYITLRPMSWMNGKYVAFGRVMD
GMHVVDAIHAVEARHNQAPKASIVITDCDVLDTSV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagtcacctcgttcaccgtctacgggctggtcccggcggcggacttccagcgt
tgtgcagaggcggcggcgtacgtgaacgacaagtacccggaatcctatgccgtcatagtg
aaactagagcttccacgagactttgccgagcggcgggctgcgtgggcgtcggcggggcat
ctgccgtcccagcagcagcagccgacagacgcctcgttcggtgagagcggtggttcagct
accacggcgtccacggctgctgccgaactagccgcggtactggtggagcagcacggcagc
gatagcgagccacagtgccttcttactgcagagacctttctgcacaacatcgctactcac
acagattataagcccgacgccacggaggactactacaccgctcgaggcaagcgtgcgtgg
cgcgccttcctcgcatcgcgtggccgacagtactgctggatggacgtgtcagtggacggc
gtggcggtggggagggtctggtttgagctgtacgcgtctgtggcaccgctgacgtgcaag
aacttctgcgagctgtgccgcggcaccacggttgccatgggcgacaccgtcgcgcacagc
agcgtattcgatccgccgccggcgcagcacatcggctacaaggggactaccttcttccgc
accttaaaggatgcgtgggtgatggggggcgacgtgaccggtgcacactctggcaacggc
gggtactcgtgctacggccgctgcttccccgatgagacgtacgccgtcccccacgatgcg
gctggcattctaggcatgtgcaacgatggcccgcacacgagcagctccgccttctacatc
acgcttcgacccatgtcatggatgaacggcaagtacgttgcctttggtcgagtcatggac
ggcatgcacgtggtggatgcgatccacgcggtcgaggcgcgtcacaaccaggccccgaaa
gcgtccatcgtcatcaccgactgcgacgtgcttgacacgagtgtgtaa

DBGET integrated database retrieval system