KEGG   Leishmania major: LMJF_16_1320Help
Entry
LMJF_16_1320      CDS       T01014                                 

Definition
(RefSeq) putative cytochrome c
  KO
K08738  cytochrome c
Organism
lma  Leishmania major
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 5650683
NCBI-ProteinID: XP_001682213
GeneDB: LmjF.16.1320
UniProt: Q4QEN5
Structure
PDB: 

Position
16:complement(535832..536173)
Genome map
AA seq 113 aa AA seqDB search
MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYS
KANAESGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtgcccctctgccgcctggtgacgtggagcgcggcgagaagctg
ttcaagggccgcgctgctcagtgccacaccgcgaccaagggcggctcgaacggtgtgggc
ccgaacctgttcggcatcgtcaaccgtccctccggcaaggtcgagggcttcacgtacagc
aaggcgaacgccgagtcaggcgtaatctggacgccggaagtgctggacgtgtacctggag
aacccgaagaagtttatgcctggcacgaagatgtcgtttgccggcatcaagaagccgcaa
gagcgcgctgacgtgatcgcgtacctcgagactctcaagtaa

DBGET integrated database retrieval system