KEGG   Leishmania major: LMJF_18_0880Help
Entry
LMJF_18_0880      CDS       T01014                                 

Gene name
CYP16
Definition
(RefSeq) putative cyclosporin 16
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
lma  Leishmania major
Brite
KEGG Orthology (KO) [BR:lma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LMJF_18_0880 (CYP16)
Enzymes [BR:lma01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     LMJF_18_0880 (CYP16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 5651016
NCBI-ProteinID: XP_001682494
GeneDB: LmjF.18.0880
UniProt: Q4QDV4
Position
18:373113..376175
Genome map
AA seq 1020 aa AA seqDB search
MCVHLDSLGALVATIDAAGVVRVWRKLPSGLFFITELDKIFLPARSAAAAGHERRTRHYW
AHAYTTLQMLVFVCTEEEEVEVDHGNVRRTESNDNGSPSSASAAQAPLSTVRVHMRQVNP
ITLTVEERDSFTFQAPVQRVVSAAVTVADTAQCRNDDGACWTPRTSLAYNRRPAFLTHQY
APHIAFFVTLPPSPATPGATGGGNGVVLCPCFASAMSAGSRPDHTAGAARSYVPTRLSVA
NAIVACAQQGWELERTGTSACVVVDSAGVVDYCTIEAAAEAATTAVTFPSTASGRRTLKV
MAGLAAVPPTSREARMWRRWICFDRRQRTGFFSLVRDAQQALKARKEDENETAAGKAAGA
VAAADVQVLPAAVQLTPDGRHVLVWSFRFLRVAAVSSQPASRIPSTERRYDVTVESCIHL
LDFTTGVCIGRHTEPLGVFATSEDIVFGATAWADYVQLRSRALALRLHVEPSAAANNQFY
VLVPELPLEQLLGAAAVSREAAEVAPAEVAGRVVHVYEVTLEAAAASSPSTAQSSATVRR
LSHEPGEWEAIVRRGAEHPRHASHHNVGDVRKDRCWSGLATSQPTWGVLRLLSPNEYALT
VKEENHTRDEAHGCVTATAGVHPGLAVCRAPLMLLRRAVTASQDLKNLVSASPVGAALGA
DARKHLFATPRAHDTASGAASGEVLLLSSSTDVSAAALLVYSSELPWGSAALGRVLSEAV
PPQTEEELTEEGQRLQEQLRQKSFVDALRELHRGRDDACGTLLLAAVAPQSSSAAAAPGG
AGEAASTSPSATADVAGSTSGGGVQPGKTTEAAATTSVRVDAARRAAPVTNEEAAVCALL
KDLTPPLSASLPPVALVHVRGYGSIRVHLLPSIAPLATDNFVRLARRHYYDRLTFHRVIP
AAIVQGGCPRGDGTGGESAFADGAPFSDEGLTLFPFFSHTANPLCCWLCMANAGPNTNGS
QFFFTVPGGEAMPWLDGHHTVFGYAVEGLDVVRAMSIAARDDEDKPLSPIIIERVDVLSA
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtccatctcgactcgctcggtgcgctggtcgccaccatcgatgcagcgggtgtt
gtgcgtgtctggcgcaagctgccgagcggtctcttcttcataacggagctggacaagata
tttctgccagctcgcagtgccgccgccgctggccacgagcgccgcacgcgtcactactgg
gcacatgcctacacgacgctgcagatgctggtgtttgtatgcacggaggaagaagaagtg
gaggtcgaccacggcaacgtgcgtcgcacggaatcgaatgataacggatcgccctcatct
gcgtccgcagcccaggcgccgctgagtacagtgcgggtgcacatgcgtcaggtcaacccc
atcaccctcactgtggaggaacgcgactccttcacctttcaggccccagtgcagcgagtc
gtcagtgccgcagtcactgtagcggacacggcgcagtgcagaaacgacgacggcgcgtgt
tggacccctcgcacctctctcgcctacaatcggcgaccagccttccttacgcatcagtac
gcgcctcacatcgccttcttcgtaacgctgccgccgtcgccggcgacgcctggtgcgacg
ggcggtggtaacggcgtcgtcctgtgcccttgcttcgcctccgccatgtcggcgggcagt
cgccccgatcatacggcgggtgccgctcgcagctacgtgccgacccgtctcagcgtagca
aacgcgatcgtggcgtgtgcgcagcagggatgggagctggagcggaccggcacctctgcc
tgcgtcgtggtggactctgctggtgttgtcgattactgcaccatcgaggcggccgccgag
gcagcgacgacggcagtgacattcccctcgactgcgtcgggaaggcggactctgaaagtg
atggcgggtcttgcggcggtgccgcccacgtcacgcgaggcgcgcatgtggcgacggtgg
atatgttttgaccgccggcagcggacaggcttcttcagcctcgtacgggatgctcagcaa
gcgctcaaggcgcgtaaagaggacgagaacgaaacagccgcaggcaaggcggctggcgcc
gtcgccgctgccgatgtgcaggtgctgccggcagcggtgcaactcacacccgacggtcgg
cacgtgttggtgtggagcttccggtttctccgagtcgcagcggtgtcgtcgcagcccgcc
tcacgcatcccgtctacggagcggcgctatgatgtaaccgtggagtcatgcatccatctg
ttggacttcacgactggcgtgtgcatcggccggcacaccgaacccctcggcgtctttgcc
accagcgaggacattgtgttcggagccacggcgtgggcggactacgttcagctccgcagc
cgcgctctggcactgcgcctacacgtggagccgtccgcagccgccaacaaccagttctac
gtcctggtgcctgagttgccgctagagcaactgcttggcgctgccgctgtgtcgcgcgag
gcggcggaggtggccccggcggaagtcgctggacgcgtggtgcatgtgtatgaggtcacc
ctcgaggcggcagccgcgtcgtcgccgagcaccgcgcagtcctcggccacagtgaggcgg
ctgtcgcacgagccgggtgagtgggaggcgatcgtcaggcggggtgcagagcacccacgg
catgcatcacaccacaacgtcggtgatgtcaggaaagaccgatgctggagtggtctggca
acctctcagcctacatggggagtgctgcgcctcctctctcccaacgagtacgccctcacg
gtcaaggaagagaatcacactcgcgatgaggctcacggttgcgtgacggcgacggctggg
gtgcacccaggtctggcggtctgccgcgccccgctgatgcttcttcgccgcgctgtgacc
gcgtcgcaggatttgaagaacttagtttccgcctcccctgtcggggctgcgttaggggcg
gacgcacgcaagcatctcttcgcgacccccagggctcatgacaccgccagcggggcagca
tcaggggaggtgctgcttctctcttccagcacggacgtctccgcagcggcgctgctggtg
tactctagcgagctgccgtggggcagtgccgccctggggcgcgtgctctccgaggctgtt
ccgccgcagaccgaggaggagctcactgaggaggggcaacgtcttcaggagcagctgcga
cagaaaagctttgtcgacgcgctgcgcgagctacaccgtggccgtgacgacgcgtgcgga
acactcctgctagccgcagtggccccgcagagctcgagcgccgccgcggcacctgggggt
gcgggcgaagcagcctccactagcccaagcgctactgcggatgtggctggcagcaccagc
ggtggtggggtgcaaccggggaagactacagaagcggcggcaacgacctcggtgagagtc
gatgccgcgagaagggccgcgcccgtaacgaacgaagaagccgcggtgtgcgcactgctg
aaggacctaaccccgccactcagtgcatcgttgccgcctgtggcgctcgtgcacgtgcgc
ggctacggctccatccgggtgcacctgctccccagcattgcgccactggcgaccgacaac
tttgtgcgcctggcacgacgccactactacgaccggctcaccttccaccgggtcattcca
gccgcgattgtgcaaggcggatgcccgcgaggcgacgggaccggcggcgagagcgccttc
gctgacggggcgccgttcagcgacgaagggctgacactttttcctttcttttcccacacg
gccaacccgctgtgctgctggctgtgcatggcgaacgcggggcccaacacgaacgggtcg
cagttcttctttaccgtgcccggcggcgaggcgatgccgtggctggacgggcaccacacc
gtcttcgggtacgccgtcgaggggcttgacgtggtgcgcgccatgagcatagcagcgcgc
gacgatgaggacaagccgctctcgcccatcataatagagcgggtggatgtgctgtctgcc
tag

DBGET integrated database retrieval system