KEGG   Leishmania major: LMJF_22_0770Help
Entry
LMJF_22_0770      CDS       T01014                                 

Definition
(RefSeq) putative NADH-cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lma  Leishmania major
Pathway
lma00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMJF_22_0770
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LMJF_22_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 5651836
NCBI-ProteinID: XP_001683228
GeneDB: LmjF.22.0770
UniProt: Q4QBS0
Position
22:complement(315686..316555)
Genome map
AA seq 289 aa AA seqDB search
MKAFIASVVGFAGASMYQSGSEVEAWGSRPAFSQEKFQPYKLIHVENESHNTKRFRFALA
SSKTRLDLPVASCITLRYTDAQGHEVMCPYTPINLVEEEGHFDLVVKCYPNSKMGSHLFS
LKVGDSIDVKGPWHTFDVKPGQYTSIGMIAGGTGLTPMFQIATNVLNAPENKTMISLLYA
NKTEGDILLGKELDTLAKEHPGKFATYHCLTTPPKRWTGYSGHINKVIIQETMPGSDHQG
DSCVLVSGPPSFMKTICGEKDYSSYPPKQGPLEGYLKELGYSSSGVFKF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttttatcgcttcggttgtcggctttgctggagccagcatgtaccagtctggg
tccgaggtggaggcctggggcagcaggccggcattctcacaagagaagttccagccctac
aagctcatccacgtcgagaatgaatcgcacaacacaaagcgctttcgctttgcgctcgct
tcgagcaagacgcgcctggacctgcccgtggcgtcttgcatcacgctgcgctacactgac
gcccagggacacgaagtgatgtgcccctacacgcccatcaacctggtggaggaagagggc
cacttcgacctcgtagtgaagtgctacccgaattcaaagatgggctcgcaccttttctct
ctcaaggtcggcgattccattgacgtgaagggaccgtggcacacattcgacgtgaagccg
ggccagtacaccagtattggcatgatcgctggtggtacgggtctcacccccatgttccaa
atcgcgacaaacgtcctgaacgcgccggaaaataagacgatgatttcgcttctgtacgca
aacaagaccgagggggacattctgctcggcaaggagctggacacactggcgaaagagcac
cccgggaagtttgccacgtaccactgcctcacgacgcctccgaagcgctggacgggctac
tctggccacatcaacaaagtgatcatccaggagacgatgccaggctcggatcaccaaggt
gactcgtgcgttctggtgagcggcccaccgtccttcatgaagaccatctgtggcgagaag
gattacagctcctacccgcccaagcaaggcccgctcgagggctacctcaaggagttgggc
tactcatcaagcggcgtcttcaagttctaa

DBGET integrated database retrieval system