KEGG   Leishmania major: LMJF_22_1680Help
Entry
LMJF_22_1680      CDS       T01014                                 

Definition
(RefSeq) putative phosphoinositide-specific phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lma  Leishmania major
Pathway
lma00562  Inositol phosphate metabolism
lma01100  Metabolic pathways
lma04070  Phosphatidylinositol signaling system
lma04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LMJF_22_1680
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LMJF_22_1680
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LMJF_22_1680
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LMJF_22_1680
Membrane trafficking [BR:lma04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    LMJF_22_1680
 Endocytosis
  Macropinocytosis
   Phospholipase C
    LMJF_22_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_7
Motif
Other DBs
NCBI-GeneID: 5651941
NCBI-ProteinID: XP_001683319
GeneDB: LmjF.22.1680
UniProt: Q4QBH9
Position
22:join(687755..688471,688474..689424)
Genome map
AA seq 555 aa AA seqDB search
MLHCSREEVGELLIDSCKRSVGTSVELDTLLSNKNTSKVAPDATAATIMQVRMMYGKDDS
GDLSYAEMTRLVEGLSSSKDLTERILKPFEDDNRHTIAFSEFAKVYSNAVSFKELGYVFQ
DLAGGQQTISRDTFASFVCDIQDEDWDAETLNEKLALMGCVGIDGITENNFVGYIMSPYF
DFAMEKKLTGVYQDMDQIMCCYFISSSHNTYLTGDQLTSKSSAQMYKKGASRRVPVREAI
CRNGPHGEPIVCHGYTRTSCIAFEECVKMIRQYAFTASAYLVILSLGVHTSVEQQDKMAE
ILEEGLGSLLFWPPWGSNEKPTMAFSPNNLKNKILVKAKRGDFPAREPRVDKDDDATETD
SMASTNNADYLKMKEARRKAGKDEVRVSAKLSAIVSIESSKYQGVKDLSYLKDKQPHHCS
SYSERKGKAIVREAHNALVCINDTCLSRVFPAGSRIDSSNYRPLLYWVSGCQMVAINWQS
SDTFGWRLNGCIFLDSGCCGYLLKPDYLRPVTCPDVAVPEYLRSLTVEVIWGFALPSAKQ
ARGCRPVCDSFPRGP
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgctgcactgcagcagggaagaggtgggcgaacttctaatcgattcttgcaaacgcagc
gtgggcacaagcgtcgagctcgacacgctcctgtcgaacaaaaacacatcaaaggtggcg
ccagatgctacggctgccacgatcatgcaggtgaggatgatgtacggcaaggacgatagc
ggcgatttgagctacgccgagatgacgcgtctggtcgaggggctcagctcttcgaaggac
ttgacagaacgaatcttgaagcccttcgaggacgacaatcgccacaccatcgccttttcc
gagtttgcgaaggtgtactcgaacgccgtgagtttcaaggagctcggctacgtcttccag
gatttggcaggtggtcagcagaccatctctcgagacaccttcgccagctttgtctgcgac
atccaagatgaggactgggatgccgagactctcaacgagaagctcgctcttatgggctgc
gtcggcatcgacggcatcaccgagaacaacttcgtcgggtacattatgagtccctacttc
gacttcgcgatggagaagaagctgacgggcgtctaccaggacatggaccagatcatgtgc
tgctacttcatcagctcctcacacaacacgtacctcaccggggaccagctcacgagcaaa
tcctccgcccagatgtacaaaaaaggtgcttctcgacgggtgccggtgcgcgaagctatt
tgccggaacggccctcacggcgagccgattgtgtgccacggctacacccgcacttcctgt
atagccttcgaagagtgcgttaagatgattcgtcagtacgccttcaccgcttccgcatac
ctcgtgatactctcgctgggggttcacacttcggtggagcagcaggataagatggcggag
attctagaagaagggctgggctcgctgctcttctggcctccgtggggctccaacgagaag
cccaccatggccttttcgcccaacaacttgaagaacaaaatcctcgtgaaagccaagcgc
ggcgacttcccagcccgcgagcctcgcgtcgacaaagacgacgatgcaaccgagacggac
tcgatggccagcacaaacaacgccgactacctgaaaatgaaggaggctcgcaggaaggcc
gggaaggacgaggtccgggtgtcagcgaagctgtctgccatcgtctccatcgagtccagc
aagtaccagggcgtcaaggacttatcatacctgaaggacaagcagccgcaccactgctct
tcgtactcagagaggaaggggaaggccatcgtccgcgaggcccacaacgcgctggtgtgc
atcaacgacacgtgccttagccgcgtcttccctgctggctcgcgcatcgacagcagcaac
tacaggccgctgctttactgggtgtctggatgccagatggtggccatcaattggcagtcc
agcgataccttcggctggcgcctcaacggctgcattttcctcgacagcggctgctgcggg
tacctcctgaagccagactatctgcggcccgtgacctgccccgatgtggctgtcccggag
tacttgcggtcgctgacagtggaagtgatttggggcttcgcgctgccgagcgcgaagcaa
gccagaggttgccgacccgtttgtgacagttttcctcgagggccctga

DBGET integrated database retrieval system