KEGG   Leishmania major: LMJF_23_0270Help
Entry
LMJF_23_0270      CDS       T01014                                 

Gene name
PTR1
Definition
(RefSeq) pteridine reductase 1
  KO
K03793  pteridine reductase [EC:1.5.1.33]
Organism
lma  Leishmania major
Brite
KEGG Orthology (KO) [BR:lma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LMJF_23_0270 (PTR1)
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.33  pteridine reductase
     LMJF_23_0270 (PTR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR
Motif
Other DBs
NCBI-GeneID: 5651987
NCBI-ProteinID: XP_001683351
GeneDB: LmjF.23.0270
UniProt: Q01782
Structure
PDB: 

Position
23:101918..102784
Genome map
AA seq 288 aa AA seqDB search
MTAPTVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAI
TVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLR
NDEDGHEPCVGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMV
DAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEG
HRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccgaccgtgccggtggcgttggtaacaggcgccgcgaagcgtcttggccgc
agtatcgctgagggactccacgcggaggggtacgctgtctgcttgcactatcatcgctct
gctgcagaagcgaacgcactatccgcgacgctcaacgcaaggcgaccgaacagcgccatc
acggtgcaggcggatctgagcaacgttgccacagccccggtcagcggcgctgatggctct
gcacctgttaccctcttcacgcgctgtgctgagttggtggctgcgtgctacacccactgg
ggacgctgcgacgtgctagtgaacaacgcctcttctttctaccccacgccgctgctgagg
aatgacgaggatggacacgagccctgtgtcggagatagagaggcaatggagacggccacc
gctgacctcttcggctccaacgcgatagcgccctacttcttgattaaggcgttcgcgcat
cgcgtcgcgggcaccccagccaagcatcgcggcaccaactactccatcatcaacatggtc
gacgccatgacgaaccagcctcttctcgggtacaccatatataccatggccaaaggggcg
ttggaggggctgacacggtctgccgcgctggagcttgcgccgctgcagattcgagtgaac
ggcgttggtccgggtttgtcggtgctcgtcgatgacatgccccctgctgtgtgggagggc
caccgcagcaaggtgcctctgtaccagcgcgattcctccgccgcagaggtgagcgacgtt
gttatctttctgtgctcctccaaggccaagtacatcaccggcacctgtgtcaaagtggat
ggtggctacagccttacccgggcctga

DBGET integrated database retrieval system