KEGG   Leishmania major: LMJF_23_0880Help
Entry
LMJF_23_0880      CDS       T01014                                 

Definition
(RefSeq) beta-fructosidase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lma  Leishmania major
Pathway
lma00052  Galactose metabolism
lma00500  Starch and sucrose metabolism
lma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LMJF_23_0880
   00500 Starch and sucrose metabolism
    LMJF_23_0880
Enzymes [BR:lma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LMJF_23_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5652072
NCBI-ProteinID: XP_001683423
GeneDB: LmjF.23.0880
UniProt: Q4QB75
Position
23:complement(435934..437475)
Genome map
AA seq 513 aa AA seqDB search
MSSQAQQRAPAYAPRDTHAERLAAADREAAARRDSSTNWTWYPEYHLAPYMGWMNDPTGL
VHFRDHYHVFYQYHPYSAEWGPMHWGHMTSEDLVHWQHEKVALAPGDACDRNGCFSGTAV
VHEDRMYVFYTGHFALDAATPSNPDAIFEQQCVAVSSDGVNFEKLGAVVRPPPGYVHFRD
PKVWQQDGRWWMVCGARDVTKDLGQLLLFTTEDLLKWDDTNWQVLGMTEDKNVFMWECPD
YFTIGSREDMKLLLFCPQGKKASEYNYRNRFQNGYTVGQWMPGGPWTVQREFRELDRGHD
FYAAQTFLAADGQRRMLMAWCNMWESPMPTKQYGWSGCLTLPRELSYNEATGQLCMLPAR
ELVGLRTPEMMIVPSLLVENNSDAQILENCTAYELDIAFNMETSTAEKYGLWLGSGAELY
VDAQSKRLVLNRHYPQHMLSGYRSCELPIGLLLQLHVFIDRSSIEVFVNNGEATFSSRVF
PDEGDRALRVFSVNGTADMVGGTMWKLKATVRH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcaagcgcagcagcgcgcgccagcctacgctccgcgcgacacccatgccgag
cggctcgcggccgcggaccgggaggccgctgcccgacgggactcctcgaccaactggaca
tggtatcccgaataccaccttgcaccgtacatggggtggatgaacgacccgacggggctg
gtgcacttccgcgatcactaccacgttttctaccagtaccacccgtacagtgccgagtgg
ggtccaatgcactggggccacatgacgagcgaggatcttgtgcactggcagcacgaaaag
gtggcgctggcaccaggcgacgcgtgcgatcgcaacggctgcttctctggcaccgccgtc
gtgcacgaagacaggatgtacgtcttctacacgggccacttcgcgcttgacgcggcgacg
ccaagcaacccggacgccatctttgagcagcagtgcgtcgccgtcagcagcgacggcgtg
aactttgagaagctcggcgccgtcgtgcgcccgccaccggggtacgtgcacttccgtgac
ccgaaggtgtggcagcaggatgggcggtggtggatggtgtgtggtgcccgtgacgtgacg
aaggaccttggccagctgctgctcttcaccacagaagacctgcttaagtgggacgacacg
aactggcaggtgctggggatgacggaggacaagaacgtgttcatgtgggagtgccccgat
tacttcacgatcggcagccgcgaggatatgaagctgcttcttttttgccctcaaggaaaa
aaggccagcgagtacaactaccgcaatcgcttccagaatgggtataccgtcgggcagtgg
atgcctggcggtccgtggacggtgcagcgggagttccgtgagcttgatcgcggccatgac
ttctacgcagcacagacgttcctcgccgccgatggccagaggcgaatgttgatggcgtgg
tgcaacatgtgggagagccccatgccgacaaagcagtatggctggagcggctgcctgacg
ctaccgcgggagctaagctataatgaggcgacagggcagctttgcatgctgccggcgcgt
gagctggtcggcctgcgtacgcccgagatgatgattgtgcctagccttcttgtagagaat
aacagcgatgctcagatccttgagaactgcactgcctacgagctcgatattgccttcaac
atggagacgagcacggcggagaagtacgggctgtggctcggctcaggggcggagctgtac
gtggacgcgcagtcgaaacggctggtgctgaaccgccactacccgcaacacatgctgagt
gggtatcgctcctgcgagctgccgattggtttgcttctgcagctgcacgtgttcattgac
cgctcgtcgattgaggtgttcgtgaacaacggcgaggccaccttctcttcccgcgtcttc
ccggacgagggcgaccgagcgttgcgcgtcttctcggtcaacgggactgcggacatggtg
ggcggtaccatgtggaagctgaaggcgacggtgaggcactga

DBGET integrated database retrieval system