KEGG   Leishmania major: LMJF_25_2140Help
Entry
LMJF_25_2140      CDS       T01014                                 

Definition
(RefSeq) putative succinyl-CoA synthetase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lma  Leishmania major
Pathway
lma00020  Citrate cycle (TCA cycle)
lma00640  Propanoate metabolism
lma01100  Metabolic pathways
lma01110  Biosynthesis of secondary metabolites
lma01130  Biosynthesis of antibiotics
lma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMJF_25_2140
   00640 Propanoate metabolism
    LMJF_25_2140
Enzymes [BR:lma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     LMJF_25_2140
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LMJF_25_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5652696
NCBI-ProteinID: XP_001683974
GeneDB: LmjF.25.2140
UniProt: Q4Q9M4
Position
25:complement(820490..821389)
Genome map
AA seq 299 aa AA seqDB search
MFARSAIRRWVNKDTKVIVQGMTGKAGTFHTKEAMAYGTKVVGGVSPKKAGTTALGVPVF
ATAAEAVKATGATASVLYVPAPLCAASIEEALDAELPLVVVITEGIPQWDMLRVKSMLLS
QNKTRLIGPNCPGIIKPAECKIGIMPGHIHQKGKIGIVSRSGTLTYEAVAQTTAEGLGQS
LCVGIGGDPFNGTNMVDCLRLFLNDPETEGIILIGEIGGTAEEEAADFIKNSPIKKPIVS
FIGGATAPPGRRMGHAGAIVSGGMGTAKGKKDALRAAGVTISDSPAHLGKHMAELFATK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcccgctccgccatccgccgctgggtcaacaaggacacgaaggtgattgtccag
ggcatgactggcaaggccggcacgttccacacgaaggaggcgatggcgtacggcaccaag
gtcgtgggcggcgtgagcccgaagaaggcgggcacgacggcgctgggcgtgccggtgttt
gcgacggctgcggaggcggtgaaggcgacgggcgcgactgcgtcggtgctgtacgtgcct
gcgcctttgtgcgctgcgtcgatcgaggaggctctggacgcggagctgccgctggttgta
gtgatcacggagggcatcccgcagtgggacatgctgcgcgtgaagtcgatgctgctgtcg
cagaacaagacacgcctgatcggccccaactgcccaggcatcatcaagcctgcggagtgc
aagatcggcatcatgcccggtcacatccaccagaagggcaagatcggcattgtgtcgcgc
agcggcacgctgacgtatgaggcggttgcgcagacgacggcggagggcctcggccagtcg
ctgtgcgtcggcattggcggcgacccgttcaacggcacaaacatggtggactgcctgagg
ctgtttctgaatgaccccgagacggagggcatcatactgattggcgagatcggcggcacc
gcggaggaggaagcggcagacttcatcaagaacagcccgatcaagaagccgatcgtgtcc
ttcatcggcggggcgactgcgccgccgggccgccgcatgggccacgccggtgctatcgtg
tctggcgggatgggcaccgcgaagggcaagaaggatgcgctgcgcgccgccggcgtgacc
atctccgactcgccggcgcaccttggcaagcacatggctgagctcttcgccacgaagtag

DBGET integrated database retrieval system